DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11807 and CG8800

DIOPT Version :9

Sequence 1:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster


Alignment Length:169 Identity:46/169 - (27%)
Similarity:78/169 - (46%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 WQE----------ITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLS 365
            |:|          :.:|......:.::|.::.|..:..|:.:..|.|..:..|:.:..|::||||
  Fly    14 WEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLS 78

  Fly   366 GNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLE 430
            .|.|.:..........|..|.|:.|.|:.:.||..|..|..|.:|:|.|::..|.|.:|.:..||
  Fly    79 RNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLE 143

  Fly   431 TLRLTGNPLAGSVD---YRSRVLARFHERAAEISLDNEP 466
            .|.:.||||:..:|   :|:..:.|.   .....||.||
  Fly   144 DLVVVGNPLSEGLDEPTWRAECIKRL---PTIRKLDGEP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785
leucine-rich repeat 315..336 CDD:275380 3/20 (15%)
LRR_8 335..414 CDD:290566 23/78 (29%)
leucine-rich repeat 337..381 CDD:275380 11/43 (26%)
LRR_4 381..422 CDD:289563 14/40 (35%)
leucine-rich repeat 382..403 CDD:275380 8/20 (40%)
leucine-rich repeat 404..428 CDD:275380 8/23 (35%)
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 43/146 (29%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.