DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11807 and CG10839

DIOPT Version :9

Sequence 1:	NP_001260990.1	Gene:	CG11807 / 36683	FlyBaseID:	FBgn0033996	Length:	491	Species:	Drosophila melanogaster
Sequence 2:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster

Alignment Length:	138	Identity:	42/138 - (30%)
Similarity:	61/138 - (44%)	Gaps:	26/138 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   353 LAELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKL--------LSLVNLD- 408
            |..|.:.|.||||.|:| |.:.....|.||..|.||:|.:|||:|:..|        :|..|::
  Fly    44 LNSLTECQKLSLSSNMI-EKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEK 107

  Fly   409 --------------LSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAE 459
                          :|.|.|::..|...:...|.|..:...||||..::| :|...|....|...
  Fly   108 TKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMD-QSAFTAEAVRRLPN 171

  Fly   460 I-SLDNEP 466
            : .||.||
  Fly   172 MKKLDGEP 179

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11807	NP_001260990.1	PX_IRAS	8..126	CDD:132785
		leucine-rich repeat	315..336	CDD:275380
		LRR_8	335..414	CDD:290566	26/83 (31%)
		leucine-rich repeat	337..381	CDD:275380	11/27 (41%)
		LRR_4	381..422	CDD:289563	17/63 (27%)
		leucine-rich repeat	382..403	CDD:275380	10/28 (36%)
		leucine-rich repeat	404..428	CDD:275380	5/38 (13%)
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	27/85 (32%)
		LRR_4	48..90	CDD:289563	19/42 (45%)
		leucine-rich repeat	50..71	CDD:275380	9/21 (43%)
		LRR_8	51..105	CDD:290566	21/54 (39%)
		leucine-rich repeat	72..94	CDD:275380	10/21 (48%)
		leucine-rich repeat	95..116	CDD:275380	2/20 (10%)
		leucine-rich repeat	117..141	CDD:275380	4/23 (17%)
		leucine-rich repeat	142..171	CDD:275380	9/29 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR15454
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100