DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11807 and SNX24

DIOPT Version :9

Sequence 1:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_011541651.1 Gene:SNX24 / 28966 HGNCID:21533 Length:246 Species:Homo sapiens


Alignment Length:98 Identity:38/98 - (38%)
Similarity:54/98 - (55%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSGGVTYYDIKVRV---GKVEWLVERRYRDFANLHEKLVGEISISKKLLP----PKKLVGNKQPS 80
            |:|.:||...|:.|   |: :..||:||.:|..||:||       ||.:.    |.|.|.|..|.
Human    46 SNGRLTYQVFKIEVLMNGR-KHFVEKRYSEFHALHKKL-------KKCIKTPEIPSKHVRNWVPK 102

  Fly    81 FLEQRREQLEIYLQELLIYFRTELPRALAEFLD 113
            .|||||:.||.|||.:::. ..|||:...:||:
Human   103 VLEQRRQGLETYLQAVILE-NEELPKLFLDFLN 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785 38/98 (39%)
leucine-rich repeat 315..336 CDD:275380
LRR_8 335..414 CDD:290566
leucine-rich repeat 337..381 CDD:275380
LRR_4 381..422 CDD:289563
leucine-rich repeat 382..403 CDD:275380
leucine-rich repeat 404..428 CDD:275380
SNX24XP_011541651.1 PX_SNX22 1..144 CDD:132790 38/98 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.