Sequence 1: | NP_001260990.1 | Gene: | CG11807 / 36683 | FlyBaseID: | FBgn0033996 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_878274.1 | Gene: | SNX20 / 124460 | HGNCID: | 30390 | Length: | 316 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 56/241 - (23%) |
---|---|---|---|
Similarity: | 88/241 - (36%) | Gaps: | 75/241 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VPKFSNESSSGGVTYYDIKVRVGKVE---WLVERRYRDFANLHEKLVGEI--SISKKLLPPKKLV 74
Fly 75 GNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLS 139
Fly 140 SKKEYNLS-ALEVYAISERLSLPCPPS--------------LDR-------------------GG 170
Fly 171 KYDFSHVLDFCTQLVALVVTPVKDNASYA--QDYNTVDVPIDRSNI 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11807 | NP_001260990.1 | PX_IRAS | 8..126 | CDD:132785 | 33/115 (29%) |
leucine-rich repeat | 315..336 | CDD:275380 | |||
LRR_8 | 335..414 | CDD:290566 | |||
leucine-rich repeat | 337..381 | CDD:275380 | |||
LRR_4 | 381..422 | CDD:289563 | |||
leucine-rich repeat | 382..403 | CDD:275380 | |||
leucine-rich repeat | 404..428 | CDD:275380 | |||
SNX20 | NP_878274.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..54 | ||
PX_SNX20 | 76..189 | CDD:132833 | 33/115 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |