DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11807 and STK11IP

DIOPT Version :9

Sequence 1:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_443134.3 Gene:STK11IP / 114790 HGNCID:19184 Length:1088 Species:Homo sapiens


Alignment Length:370 Identity:91/370 - (24%)
Similarity:142/370 - (38%) Gaps:99/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDF------ 180
            ||..||.|..||||.:||.              ...||| ..|:|.:     .:||.:.      
Human     9 LLWKLAGLLRESGDVVLSG--------------CSTLSL-LTPTLQQ-----LNHVFELHLGPWG 53

  Fly   181 --CTQLVALVVTPVKDNASYAQDYNTVDV----------------PIDRSNIIPNRLSFNLNAFR 227
              .|..|||...|. |:....|.....||                |.....|.|         |:
Human    54 PGQTGFVALPSHPA-DSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFP---------FK 108

  Fly   228 NLKTLKFSALSTENIVDIELLKPTLQT-ICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILAS 291
            :|:.|:...:....:..:..:...|:| ||  :.::|.:.::|                      
Human   109 SLRHLELRGVPLHCLHGLRGIYSQLETLIC--SRSLQALEELL---------------------- 149

  Fly   292 PSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQN-LAE 355
                   ::.|....||..|..:...:.:.|.||.:|.|:|....||.|.|..|:::..|. |.:
Human   150 -------SACGGDFCSALPWLALLSANFSYNALTALDSSLRLLSALRFLNLSHNQVQDCQGFLMD 207

  Fly   356 LPQLQLLSLSGNLIAECVDWHLT--MG----NLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQI 414
            |.:|..|.:|.|.:      ||.  ||    .|..|.|..|::::|.||.:|.:|.:|||:.|.:
Human   208 LCELHHLDISYNRL------HLVPRMGPSGAALGVLILRGNELRSLHGLEQLRNLRHLDLAYNLL 266

  Fly   415 EELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAE 459
            |...|::.:..|..|..|.|.||||....::|:........||.:
Human   267 EGHRELSPLWLLAELRKLYLEGNPLWFHPEHRAATAQYLSPRARD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785 2/3 (67%)
leucine-rich repeat 315..336 CDD:275380 6/20 (30%)
LRR_8 335..414 CDD:290566 29/85 (34%)
leucine-rich repeat 337..381 CDD:275380 16/50 (32%)
LRR_4 381..422 CDD:289563 15/40 (38%)
leucine-rich repeat 382..403 CDD:275380 8/20 (40%)
leucine-rich repeat 404..428 CDD:275380 8/23 (35%)
STK11IPNP_443134.3 LIP1 4..93 CDD:318176 27/104 (26%)
LRR <101..>301 CDD:227223 61/245 (25%)
LRR 1 109..130 2/20 (10%)
LRR 2 132..152 6/50 (12%)
leucine-rich repeat 160..187 CDD:275380 7/26 (27%)
LRR 3 164..185 6/20 (30%)
LRR 4 187..209 7/21 (33%)
leucine-rich repeat 188..210 CDD:275380 8/21 (38%)
LRR 5 210..231 8/26 (31%)
leucine-rich repeat 211..233 CDD:275380 8/27 (30%)
LRR 6 233..254 7/20 (35%)
leucine-rich repeat 234..255 CDD:275380 8/20 (40%)
LRR 7 255..276 7/20 (35%)
leucine-rich repeat 256..280 CDD:275380 8/23 (35%)
LRR 8 280..301 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..533
HypA <668..719 CDD:327519
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 724..780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 978..1009
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.