DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11807 and nisch

DIOPT Version :9

Sequence 1:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_031755760.1 Gene:nisch / 100170568 XenbaseID:XB-GENE-5968394 Length:1362 Species:Xenopus tropicalis


Alignment Length:471 Identity:163/471 - (34%)
Similarity:250/471 - (53%) Gaps:44/471 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TYYDIKVRVGKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLVGNKQPSFLEQRREQLEIY 92
            |.|.|::|.|...|.|..||.||.:|||||..|..|.:.||||||::|....|.:|:|::.||:|
 Frog    24 TVYIIQLRAGSFHWEVRHRYSDFYDLHEKLTAENKIERNLLPPKKMIGKNSRSLVEKRQKDLELY 88

  Fly    93 LQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISER 157
            ||.||..|...:|:|||.||.|:.|:|..:...||:.....|:.||.:.:.:.::.|::||:::.
 Frog    89 LQTLLGTFPLAVPKALARFLHFHLYEIHGIAAVLAEELFHKGEQLLLAGEVFTVTPLQLYAVTQL 153

  Fly   158 LSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFN 222
            |....|.......:.|..|::||..:|..|.::....             |:..|||....|..:
 Frog   154 LRRAKPTCSTGDARNDLGHIMDFACRLKYLRISGRTG-------------PVGTSNIHEQSLPCD 205

  Fly   223 LNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPS----L 283
            |:.|::|..::.|..:...:..:...:.:|.||.:                   ||...|    |
 Frog   206 LSIFKSLCQIEVSQCNARLLSGLTSCRRSLATISI-------------------HCSASSMKDIL 251

  Fly   284 LPETI---LASPSGSGPSTSNGSALVS-ADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQ 344
            :||..   ...|.|..|    ||.:.: ...|:.:|.|||:.|.::.||.||:..|::..|....
 Frog   252 VPEAYDFEQWEPEGVAP----GSPITAVVPKWKVLTTLDLSHNRISCIDESVKLIPEIEFLDFSH 312

  Fly   345 NRIRTVQNLAELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDL 409
            |.|.|::||..|..|..|.||.|.:|:....:..:||:.||.||.|.:::|.||.||.|||||||
 Frog   313 NDISTIENLQHLYNLIHLDLSYNKLADLTGIYTKVGNIKTLSLAGNVLESLRGLNKLYSLVNLDL 377

  Fly   410 SSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLDNEPGNQQELDT 474
            |.|:||:|:||.::..||.||.:.|.||||....|||::|||.|.:||:|:.||:....::||||
 Frog   378 SQNRIEQLEEVRNIGGLPCLEGVLLAGNPLTVIPDYRTKVLALFGDRASEVCLDSTRTTEKELDT 442

  Fly   475 ALVLSALLQSKQRQQQ 490
            ..||.|:.:|:..:.:
 Frog   443 VEVLKAIQKSRDARNK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785 45/97 (46%)
leucine-rich repeat 315..336 CDD:275380 9/20 (45%)
LRR_8 335..414 CDD:290566 35/78 (45%)
leucine-rich repeat 337..381 CDD:275380 13/43 (30%)
LRR_4 381..422 CDD:289563 25/40 (63%)
leucine-rich repeat 382..403 CDD:275380 10/20 (50%)
leucine-rich repeat 404..428 CDD:275380 14/23 (61%)
nischXP_031755760.1 PX_IRAS 16..122 CDD:132785 45/97 (46%)
PPP1R42 <282..419 CDD:411060 62/136 (46%)
leucine-rich repeat 282..304 CDD:275380 9/21 (43%)
leucine-rich repeat 305..326 CDD:275380 7/20 (35%)
leucine-rich repeat 327..349 CDD:275380 6/21 (29%)
leucine-rich repeat 350..371 CDD:275380 10/20 (50%)
leucine-rich repeat 372..396 CDD:275380 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8071
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006271
OrthoInspector 1 1.000 - - oto104654
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4560
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.