powered by:
Protein Alignment GPHR and znf236
DIOPT Version :9
Sequence 1: | NP_611016.2 |
Gene: | GPHR / 36682 |
FlyBaseID: | FBgn0033995 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012820832.1 |
Gene: | znf236 / 100144676 |
XenbaseID: | XB-GENE-996915 |
Length: | 1925 |
Species: | Xenopus tropicalis |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 15/43 - (34%) |
Gaps: | 13/43 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 390 FCSSVLLMRMNMPAEYRVIITEVLGNLHFNFYHRWFDVIFLVS 432
:||.....:.|| .||....|.:.|:|..||
Frog 1858 YCSMTFTQKCNM-------------KLHMKRTHAYPDLIEEVS 1887
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165176623 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.