DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPHR and znf236

DIOPT Version :9

Sequence 1:NP_611016.2 Gene:GPHR / 36682 FlyBaseID:FBgn0033995 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_012820832.1 Gene:znf236 / 100144676 XenbaseID:XB-GENE-996915 Length:1925 Species:Xenopus tropicalis


Alignment Length:43 Identity:11/43 - (25%)
Similarity:15/43 - (34%) Gaps:13/43 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 FCSSVLLMRMNMPAEYRVIITEVLGNLHFNFYHRWFDVIFLVS 432
            :||.....:.||             .||....|.:.|:|..||
 Frog  1858 YCSMTFTQKCNM-------------KLHMKRTHAYPDLIEEVS 1887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPHRNP_611016.2 GPHR_N 141..208 CDD:289314
ABA_GPCR 277..443 CDD:289215 11/43 (26%)
znf236XP_012820832.1 COG5048 <25..230 CDD:227381
C2H2 Zn finger 37..57 CDD:275368
C2H2 Zn finger 66..86 CDD:275368
C2H2 Zn finger 93..113 CDD:275368
C2H2 Zn finger 121..141 CDD:275370
C2H2 Zn finger 153..173 CDD:275368
zf-C2H2 195..217 CDD:333835
C2H2 Zn finger 197..217 CDD:275368
COG5048 221..>560 CDD:227381
C2H2 Zn finger 225..245 CDD:275368
C2H2 Zn finger 253..274 CDD:275368
C2H2 Zn finger 285..306 CDD:275368
C2H2 Zn finger 501..521 CDD:275368
C2H2 Zn finger 529..549 CDD:275368
C2H2 Zn finger 557..577 CDD:275368
zf-H2C2_2 569..594 CDD:372612
C2H2 Zn finger 585..605 CDD:275370
COG5048 672..1089 CDD:227381
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..725 CDD:275368
C2H2 Zn finger 733..753 CDD:275368
C2H2 Zn finger 761..781 CDD:275368
COG5048 981..>1292 CDD:227381
C2H2 Zn finger 983..1003 CDD:275368
C2H2 Zn finger 1011..1031 CDD:275368
C2H2 Zn finger 1039..1059 CDD:275368
C2H2 Zn finger 1186..1206 CDD:275368
C2H2 Zn finger 1214..1234 CDD:275368
C2H2 Zn finger 1242..1262 CDD:275368
C2H2 Zn finger 1270..1290 CDD:275370
C2H2 Zn finger 1735..1756 CDD:275368
zf-C2H2 1762..1784 CDD:333835
C2H2 Zn finger 1764..1784 CDD:275368
C2H2 Zn finger 1800..1820 CDD:275368
zf-H2C2_2 1813..1837 CDD:372612
C2H2 Zn finger 1828..1848 CDD:275368
zf-H2C2_2 1840..1865 CDD:372612 2/6 (33%)
C2H2 Zn finger 1856..1877 CDD:275368 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165176623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.