DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and PCP4L1

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_016857643.1 Gene:PCP4L1 / 654790 HGNCID:20448 Length:71 Species:Homo sapiens


Alignment Length:51 Identity:23/51 - (45%)
Similarity:29/51 - (56%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 NKDAPEDEDIQEITKKVA---EELDIDLTDPELNKAATKIQASFRGHKTRK 235
            |:.|.::|..:....|.|   ||:|||||.||..|||..||..||..:.||
Human    16 NQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRK 66

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 7/23 (30%)
IQ 169..185 CDD:197470