DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and Nrgn

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_071312.1 Gene:Nrgn / 64011 MGIID:1927184 Length:78 Species:Mus musculus


Alignment Length:42 Identity:23/42 - (54%)
Similarity:24/42 - (57%) Gaps:10/42 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
            |:||          |||.|.||..|.||.|||||||||..||
Mouse    13 DDDI----------LDIPLDDPGANAAAAKIQASFRGHMARK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 3/14 (21%)
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094
globin helix A 196..209 CDD:412094 2/12 (17%)
IQ 216..235 CDD:197470 12/18 (67%)
NrgnNP_071312.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..78 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7051
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.