powered by:
Protein Alignment igl and Nrgn
DIOPT Version :9
Sequence 1: | NP_477060.1 |
Gene: | igl / 36681 |
FlyBaseID: | FBgn0013467 |
Length: | 240 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_071312.1 |
Gene: | Nrgn / 64011 |
MGIID: | 1927184 |
Length: | 78 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 23/42 - (54%) |
Similarity: | 24/42 - (57%) |
Gaps: | 10/42 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 DEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
|:|| |||.|.||..|.||.|||||||||..||
Mouse 13 DDDI----------LDIPLDDPGANAAAAKIQASFRGHMARK 44
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X7051 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.870 |
|
Return to query results.
Submit another query.