powered by:
Protein Alignment igl and nrgna
DIOPT Version :9
Sequence 1: | NP_477060.1 |
Gene: | igl / 36681 |
FlyBaseID: | FBgn0013467 |
Length: | 240 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001289549.1 |
Gene: | nrgna / 567608 |
ZFINID: | ZDB-GENE-090710-4 |
Length: | 60 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 25/44 - (56%) |
Similarity: | 27/44 - (61%) |
Gaps: | 10/44 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 PEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
|:|||| :||.|.||..||||.||||.||||.|||
Zfish 11 PQDEDI----------MDIPLDDPAANKAAAKIQAGFRGHMTRK 44
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R8834 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X7051 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.