DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and nrgna

DIOPT Version :10

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001289549.1 Gene:nrgna / 567608 ZFINID:ZDB-GENE-090710-4 Length:60 Species:Danio rerio


Alignment Length:44 Identity:25/44 - (56%)
Similarity:27/44 - (61%) Gaps:10/44 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
            |:||||          :||.|.||..||||.||||.||||.|||
Zfish    11 PQDEDI----------MDIPLDDPAANKAAAKIQAGFRGHMTRK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQCD 99..>121 CDD:467745
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 5/16 (31%)
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094
globin helix A 196..209 CDD:412094 2/12 (17%)
IQCD 216..>238 CDD:467745 15/20 (75%)
nrgnaNP_001289549.1 Adgb_C_mid-like <27..>55 CDD:412094 15/18 (83%)
IQ motif 31..49 CDD:412094 11/14 (79%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.