DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and spa17

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001073148.1 Gene:spa17 / 564082 ZFINID:ZDB-GENE-061027-337 Length:660 Species:Danio rerio


Alignment Length:267 Identity:63/267 - (23%)
Similarity:102/267 - (38%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SQELKTKDGAAMDAVSNGEPEPSAPPLEGESSKSSASNHTNH-------------AKSSSIISNG 57
            |.|:.......:|.:.....:......|.|:..||...:|:.             .|..|.:::.
Zfish   377 SDEIHDSKSEVVDVLDKVHHQCDTRTGEEEAENSSDEENTSKILDALNEEDFLETPKPVSQMNDS 441

  Fly    58 EAKAANGGGAVGGGSGKSEATN--GIDRPCDKAAITEFNDDEDEAKAATKIQAVFRGHKVRETMK 120
            ||:|:|            |..|  ..::..:...:.|.:|.:.:...|.::..     .:...::
Zfish   442 EAEASN------------EILNADAFEKDLNTENVNEGSDLDSDGFEAEEMDL-----DISNVLQ 489

  Fly   121 KSETKTATNNGSAAGAAPSAAAAEAAASAEPTKAEL------------EAEFDPNDKDLCHAALK 173
            .:|.||..:..........|.:....|:.||.:.|.            :.|...||.|. .|.|:
Zfish   490 PNEEKTEDDGNHDPEPEEDAFSEAEQANPEPLENETVVVNEELFESQEQTENTENDVDQ-EAQLE 553

  Fly   174 IQSTFRGHLARKLVNKDAPEDEDI----QEITKKVAEE--LDIDLTDPELNKAATKIQASFRGHK 232
            .|   |..:....:..:..|:.||    :|.::...||  :||.|.|||.||||.||||.||||.
Zfish   554 EQ---RDKIQEMTLESENLENTDISEPKEESSQPQEEEDIMDIPLDDPEANKAAAKIQAGFRGHM 615

  Fly   233 TRKDANP 239
            |||...|
Zfish   616 TRKKMKP 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 8/56 (14%)
IQ motif 104..122 CDD:412094 0/17 (0%)
Adgb_C_mid-like <169..>209 CDD:412094 10/45 (22%)
IQ 169..185 CDD:197470 4/15 (27%)
IQ motif 172..189 CDD:412094 3/16 (19%)
globin helix A 196..209 CDD:412094 5/18 (28%)
IQ 216..235 CDD:197470 14/18 (78%)
spa17NP_001073148.1 DD_CABYR_SP17 12..50 CDD:213047
IQ 599..621 CDD:197470 16/21 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106874
Panther 1 1.100 - - LDO PTHR10699
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8834
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.