DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and SPA17

DIOPT Version :10

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_059121.1 Gene:SPA17 / 53340 HGNCID:11210 Length:151 Species:Homo sapiens


Alignment Length:111 Identity:30/111 - (27%)
Similarity:37/111 - (33%) Gaps:39/111 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVSNGEPEPSAPPLEGESSKSSASNHTNHAKSSSIISNGEAKAANGGGAVGGGSGKSEATNGIDR 83
            |....||...:.|.:.||..|.....|    |.:|:.:.|                         
Human    73 AFEEQEPPEKSDPKQEESQISGKEEET----SVTILDSSE------------------------- 108

  Fly    84 PCDKAAITEFNDDEDEAKAATKIQAVFRGHKVRETMKKSETKTATN 129
                      .|.|.|..||.||||.||||..||..||.:|.:..|
Human   109 ----------EDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQN 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 18/54 (33%)
IQCD 99..>121 CDD:467745 13/21 (62%)
IQ motif 104..122 CDD:412094 11/17 (65%)
Adgb_C_mid-like <169..>209 CDD:412094
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094
globin helix A 196..209 CDD:412094
IQCD 216..>238 CDD:467745
SPA17NP_059121.1 DD_CABYR_SP17 9..50 CDD:438521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..115 13/80 (16%)
IQCD <117..138 CDD:467745 14/20 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..151 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.