DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and PCP4

DIOPT Version :10

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_006189.2 Gene:PCP4 / 5121 HGNCID:8742 Length:62 Species:Homo sapiens


Alignment Length:47 Identity:20/47 - (42%)
Similarity:27/47 - (57%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 KDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
            ||....|:  :..|||.||.|||:..||..:||..||:.||..:.:|
Human    13 KDKTSGEN--DGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQCD 99..>121 CDD:467745
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 8/19 (42%)
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094 20/47 (43%)
globin helix A 196..209 CDD:412094 5/12 (42%)
IQCD 216..>238 CDD:467745 8/20 (40%)
PCP4NP_006189.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 12/27 (44%)
Acidic, binds calcium and is required for modulating the calcium-binding kinetics of calmodulin. /evidence=ECO:0000269|PubMed:23204517 28..40 7/11 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.