DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and PCP4

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_006189.2 Gene:PCP4 / 5121 HGNCID:8742 Length:62 Species:Homo sapiens


Alignment Length:47 Identity:20/47 - (42%)
Similarity:27/47 - (57%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 KDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235
            ||....|:  :..|||.||.|||:..||..:||..||:.||..:.:|
Human    13 KDKTSGEN--DGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 8/19 (42%)
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094 20/47 (43%)
globin helix A 196..209 CDD:412094 5/12 (42%)
IQ 216..235 CDD:197470 7/18 (39%)
PCP4NP_006189.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 12/27 (44%)
Acidic, binds calcium and is required for modulating the calcium-binding kinetics of calmodulin. /evidence=ECO:0000269|PubMed:23204517 28..40 7/11 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.