Sequence 1: | NP_477060.1 | Gene: | igl / 36681 | FlyBaseID: | FBgn0013467 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006758.1 | Gene: | spa17 / 448437 | XenbaseID: | XB-GENE-958602 | Length: | 495 | Species: | Xenopus tropicalis |
Alignment Length: | 334 | Identity: | 78/334 - (23%) |
---|---|---|---|
Similarity: | 111/334 - (33%) | Gaps: | 104/334 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GCNTSQELKTKDGAAMDAVSNGEP---------EPSAPPLEGESSK--SSASNHTNH-------- 47
Fly 48 -------AKS----SSIISNGEA-KAANGGGAVGG----GSGKSEATNG--IDRPCDKAAITEFN 94
Fly 95 ----DD---EDEAKAATKIQAVFRGHKVRE-----TMKKSETKTATN------------------ 129
Fly 130 NGSAAGAAPSAAAAEA------------AASAEPT-------------------KAELEAEFDPN 163
Fly 164 DKDLCHAALKI--QSTFRGHLARKLVNKDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQA 226
Fly 227 SFRGHKTRK 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
igl | NP_477060.1 | Adgb_C_mid-like | <74..>129 | CDD:412094 | 19/68 (28%) |
IQ motif | 104..122 | CDD:412094 | 6/22 (27%) | ||
Adgb_C_mid-like | <169..>209 | CDD:412094 | 8/41 (20%) | ||
IQ | 169..185 | CDD:197470 | 3/17 (18%) | ||
IQ motif | 172..189 | CDD:412094 | 3/18 (17%) | ||
globin helix A | 196..209 | CDD:412094 | 2/12 (17%) | ||
IQ | 216..235 | CDD:197470 | 12/18 (67%) | ||
spa17 | NP_001006758.1 | DD_CABYR_SP17 | 12..50 | CDD:213047 | |
MDN1 | <159..488 | CDD:331582 | 74/314 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR10699 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R8834 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.040 |