DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and CG14687

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_650018.1 Gene:CG14687 / 41297 FlyBaseID:FBgn0037835 Length:138 Species:Drosophila melanogaster


Alignment Length:160 Identity:47/160 - (29%)
Similarity:60/160 - (37%) Gaps:64/160 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EDEAKAATKIQAVFRGHKVRETMKKS--------------------ETKTATNNGSAAGAAPSAA 141
            :.|..||.||||.|||::||:.:.:|                    |.:..|.|...:|.....|
  Fly    15 QSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQRQRPKNNGLMENQNNTGNPRPSGEDQHTA 79

  Fly   142 AAEAAASAEPTKAELEAEFDPNDKDLCHAALKIQSTFRGHLARKLVNKDAPEDEDIQEITKKVAE 206
            ......|.|.                 .:|.|||:.|||.|.||               .:|:| 
  Fly    80 TENGGKSVED-----------------RSATKIQAGFRGFLVRK---------------KQKIA- 111

  Fly   207 ELDIDLTDPELNKAATKIQASFRGHKTRKD 236
                  ||     ||.||||.|||.||||:
  Fly   112 ------TD-----AAVKIQAGFRGFKTRKE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 14/51 (27%)
IQ motif 104..122 CDD:412094 9/17 (53%)
Adgb_C_mid-like <169..>209 CDD:412094 12/39 (31%)
IQ 169..185 CDD:197470 8/15 (53%)
IQ motif 172..189 CDD:412094 9/16 (56%)
globin helix A 196..209 CDD:412094 2/12 (17%)
IQ 216..235 CDD:197470 11/18 (61%)
CG14687NP_650018.1 IQ 17..36 CDD:197470 12/18 (67%)
IQ 88..109 CDD:197470 11/52 (21%)
IQ 112..132 CDD:279006 15/24 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.