DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and ZK1320.13

DIOPT Version :10

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001370191.1 Gene:ZK1320.13 / 3565061 WormBaseID:WBGene00044007 Length:68 Species:Caenorhabditis elegans


Alignment Length:41 Identity:17/41 - (41%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHK 232
            |::......|....||:||:|.||::..||.|||..|||.:
 Worm    12 PQENGAAGSTSNNQEEIDINLEDPQVQDAAKKIQNVFRGKR 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQCD 99..>121 CDD:467745
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 4/16 (25%)
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094
globin helix A 196..209 CDD:412094 3/12 (25%)
IQCD 216..>238 CDD:467745 8/17 (47%)
ZK1320.13NP_001370191.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.