DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and gap43

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_571416.1 Gene:gap43 / 30608 ZFINID:ZDB-GENE-990415-87 Length:194 Species:Danio rerio


Alignment Length:165 Identity:46/165 - (27%)
Similarity:65/165 - (39%) Gaps:41/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RPCDK--AAITEFNDD-----EDEAKAATKIQAVFRGHKVRETMKKSE----------------- 123
            :|.:|  .|..|...|     |:..||||||||.||||..|:.||..|                 
Zfish     9 KPVEKNEEADQEIKQDGIKPEENAHKAATKIQASFRGHITRKKMKDGEKEEENGEVPEEQEEEKP 73

  Fly   124 --TKTATNN-------GSAAGAAPSAAAAEAAASAEPTKAEL-----EAEFDPNDKDLCHAALKI 174
              ..|.|..       .|.|..||..|||:.|.|..|.|.|:     |.| .|.:::...||...
Zfish    74 ADASTETQEDPKPEQPNSPANEAPPTAAADPAPSDTPAKEEVKEPQQEVE-KPKEEEQSSAAADE 137

  Fly   175 QSTFRGHLARKLVNKDAPEDEDIQEITKKVAEELD 209
            :....|:..::  .|:..:..|:.|...:...::|
Zfish   138 KPEEEGNAQKE--EKEEEKPADVPEAESQETHQID 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 23/71 (32%)
IQ motif 104..122 CDD:412094 12/17 (71%)
Adgb_C_mid-like <169..>209 CDD:412094 6/39 (15%)
IQ 169..185 CDD:197470 3/15 (20%)
IQ motif 172..189 CDD:412094 1/16 (6%)
globin helix A 196..209 CDD:412094 2/12 (17%)
IQ 216..235 CDD:197470
gap43NP_571416.1 IQ 33..53 CDD:279006 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10699
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.