DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and GAP43

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001123536.1 Gene:GAP43 / 2596 HGNCID:4140 Length:274 Species:Homo sapiens


Alignment Length:206 Identity:55/206 - (26%)
Similarity:77/206 - (37%) Gaps:64/206 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EFNDD-----------EDEA-KAATKIQAVFRGHKVRETM---KKSETKTATNNGSAAGAAPSA- 140
            |.|||           ||:| ||||||||.||||..|:.:   ||.:.:.|....:....||.| 
Human    48 EKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVAD 112

  Fly   141 ---------AAAEAAASA-----EPTKA------ELEAEFD----------PNDKDLCHAALKIQ 175
                     ..||||.:.     ||.||      |.:.|.|          |...:....:.:.:
Human   113 GVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETE 177

  Fly   176 STFRGHLARKLVNK--DAPEDEDIQE------ITKKVAEELDIDLTDPELNKAATKIQA---SFR 229
            |..:........:|  |||..|:.::      :|...|       |.|....||.|..|   :..
Human   178 SATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAA-------TTPAAEDAAAKATAQPPTET 235

  Fly   230 GHKTRKDANPE 240
            |..::.:.|.|
Human   236 GESSQAEENIE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 23/51 (45%)
IQ motif 104..122 CDD:412094 11/20 (55%)
Adgb_C_mid-like <169..>209 CDD:412094 8/47 (17%)
IQ 169..185 CDD:197470 1/15 (7%)
IQ motif 172..189 CDD:412094 1/16 (6%)
globin helix A 196..209 CDD:412094 2/18 (11%)
IQ 216..235 CDD:197470 5/21 (24%)
GAP43NP_001123536.1 IQ 66..88 CDD:197470 14/21 (67%)
DUF2413 89..>203 CDD:287302 24/113 (21%)
Neuromodulin 107..274 CDD:284117 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10699
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.