DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and Pcp4

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001257467.1 Gene:Pcp4 / 25510 RGDID:3271 Length:94 Species:Rattus norvegicus


Alignment Length:68 Identity:23/68 - (33%)
Similarity:33/68 - (48%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CHAALKIQSTFRGHLARKLVNKDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHK 232
            |..:.|.:....|:     .:.:|||...    .|||.||.|||:..||..:||..||:.||..:
  Rat    31 CSVSKKAKRICSGN-----ASLEAPEIYG----QKKVQEEFDIDMDAPETERAAVAIQSQFRKFQ 86

  Fly   233 TRK 235
            .:|
  Rat    87 KKK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094
IQ motif 104..122 CDD:412094
Adgb_C_mid-like <169..>209 CDD:412094 10/39 (26%)
IQ 169..185 CDD:197470 2/15 (13%)
IQ motif 172..189 CDD:412094 2/16 (13%)
globin helix A 196..209 CDD:412094 5/12 (42%)
IQ 216..235 CDD:197470 7/18 (39%)
Pcp4NP_001257467.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.