powered by:
Protein Alignment igl and Pcp4
DIOPT Version :9
Sequence 1: | NP_477060.1 |
Gene: | igl / 36681 |
FlyBaseID: | FBgn0013467 |
Length: | 240 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257467.1 |
Gene: | Pcp4 / 25510 |
RGDID: | 3271 |
Length: | 94 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 23/68 - (33%) |
Similarity: | 33/68 - (48%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 CHAALKIQSTFRGHLARKLVNKDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHK 232
|..:.|.:....|: .:.:|||... .|||.||.|||:..||..:||..||:.||..:
Rat 31 CSVSKKAKRICSGN-----ASLEAPEIYG----QKKVQEEFDIDMDAPETERAAVAIQSQFRKFQ 86
Fly 233 TRK 235
.:|
Rat 87 KKK 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.