DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and Spa17

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_011240741.2 Gene:Spa17 / 20686 MGIID:1333778 Length:189 Species:Mus musculus


Alignment Length:131 Identity:34/131 - (25%)
Similarity:49/131 - (37%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDGAAMDAVSNGEPEPSA-----PPLEGESSKSSASN---HTNHAKSSSIISNGEAKAANGGGAV 68
            |..||....:.|.|.|::     ...:.|..|...||   |.||..........:.:.......:
Mouse    63 KPSAARRGAAQGAPLPASVVKKKRKKKKEKKKRLPSNEIKHWNHPHQLEEKEEEQEQVEKCEQEL 127

  Fly    69 GGGSGKSEATNGIDRPCDKAAITEFNDD-----EDEAKAATKIQAVFRGHKVRETMKKSETKTAT 128
            ...||:.|           ..:|.|.:.     |.|..||.|||::||||..||.:||.::....
Mouse   128 AKSSGREE-----------TPVTPFEESTEEEREQEEAAALKIQSLFRGHVAREEVKKMKSDKNE 181

  Fly   129 N 129
            |
Mouse   182 N 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 18/59 (31%)
IQ motif 104..122 CDD:412094 10/17 (59%)
Adgb_C_mid-like <169..>209 CDD:412094
IQ 169..185 CDD:197470
IQ motif 172..189 CDD:412094
globin helix A 196..209 CDD:412094
IQ 216..235 CDD:197470
Spa17XP_011240741.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106874
Panther 1 1.100 - - LDO PTHR10699
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8834
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.