DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igl and F39H12.3

DIOPT Version :9

Sequence 1:NP_477060.1 Gene:igl / 36681 FlyBaseID:FBgn0013467 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_508165.2 Gene:F39H12.3 / 185505 WormBaseID:WBGene00018214 Length:210 Species:Caenorhabditis elegans


Alignment Length:139 Identity:48/139 - (34%)
Similarity:59/139 - (42%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AATKIQAVFRGHKVRETMKKSETKTATNNGSAAGAAPSAAAAEAAASAEPTKAELEAEF-----D 161
            |||||||.|:||.||...:|....|.|:         |:...::|.:.:..|......:     .
 Worm    84 AATKIQAAFKGHLVRAHPEKYGMSTRTS---------SSEKLDSANNKKDQKRHSVGGYTIDVDT 139

  Fly   162 PNDKDLCHAALKIQSTFRGHLARKLVNKDAPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQA 226
            |.|:    ||.||||..||.|.||.|:|...||.|                       |||||||
 Worm   140 PEDR----AATKIQSEIRGFLTRKHVDKMKKEDTD-----------------------AATKIQA 177

  Fly   227 SFRGHKTRK 235
            ..||..|||
 Worm   178 HIRGFLTRK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iglNP_477060.1 Adgb_C_mid-like <74..>129 CDD:412094 14/26 (54%)
IQ motif 104..122 CDD:412094 10/17 (59%)
Adgb_C_mid-like <169..>209 CDD:412094 16/39 (41%)
IQ 169..185 CDD:197470 9/15 (60%)
IQ motif 172..189 CDD:412094 10/16 (63%)
globin helix A 196..209 CDD:412094 1/12 (8%)
IQ 216..235 CDD:197470 10/18 (56%)
F39H12.3NP_508165.2 DD_CABYR_SP17 9..47 CDD:213047
COG5022 <142..>205 CDD:227355 29/72 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10699
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.