DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7544 and mett-10

DIOPT Version :9

Sequence 1:NP_001163156.1 Gene:CG7544 / 36680 FlyBaseID:FBgn0033994 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001379069.1 Gene:mett-10 / 191526 WormBaseID:WBGene00014228 Length:479 Species:Caenorhabditis elegans


Alignment Length:298 Identity:111/298 - (37%)
Similarity:175/298 - (58%) Gaps:16/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MHPRNVLRTQ-PDYTKMAIKYKDFRQQCQLELNGKVSVNFRNEKTLRELTKMLLKEYYDLDVDFA 76
            |||||..|.: ||:..:|::|.:||:.||...||||:.:|:.:..:|.||:.|||:.::|||:..
 Worm     7 MHPRNPYRNKPPDFKALAVEYPEFRKFCQYVSNGKVTFDFKKDAAVRCLTQTLLKKDFNLDVEIP 71

  Fly    77 PGSLVPTLALRLNYILWLEDLMEPLNL-QNIRGIDIGCGSSCIYSLLGAKKNGWHMLALESKPQN 140
            ||.|||.:..:|||.|.::||::...| :|:.|||||.|:|||::|:||::..|..:|.:...::
 Worm    72 PGHLVPRVPQKLNYCLLIDDLLKANKLTKNVIGIDIGTGTSCIHALIGARQFNWKFIATDGDEKS 136

  Fly   141 IEYAKENVKRNHMESLI-EVYAQPDNTNIFKSYFEQDQQQLQYQFCLCNPPFF-----DSNLPNP 199
            :..|.|||.:|.:.|.| .|:..||...:..... .......|.||:||||||     |......
 Worm   137 VRVAHENVAKNGLSSSICVVHVNPDVKTVLMDVV-NTIPDTDYAFCMCNPPFFEKGNGDDKFCED 200

  Fly   200 LGGNTRN------PERRPAPNNARTGSQEELTCVGGEVQFVQRIIDESLENKERVRIFTTMLGVK 258
            :..:|..      .|.|.||::|...|..||...||||.||.||||:|:..::|::|:|||:|.|
 Worm   201 ISSSTETYSNRVASEFRTAPHSATFASSAELFVDGGEVAFVNRIIDDSVLLRDRIKIYTTMIGRK 265

  Fly   259 ANVPRILDYLKEL-QVANVSTTEFHQGHTTRWAVAWSF 295
            :::..:.:.|:.. ....:..:..:||.|.||.:||:|
 Worm   266 SSLKPLQNRLQRFGDDVKIMISVLNQGKTKRWMLAWTF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7544NP_001163156.1 AdoMet_MTases 45..295 CDD:302624 95/263 (36%)
mett-10NP_001379069.1 AdoMet_MTases 1..303 CDD:418430 110/296 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165739
Domainoid 1 1.000 198 1.000 Domainoid score I1794
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34653
Inparanoid 1 1.050 198 1.000 Inparanoid score I2487
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1358504at2759
OrthoFinder 1 1.000 - - FOG0004817
OrthoInspector 1 1.000 - - oto20439
orthoMCL 1 0.900 - - OOG6_102749
Panther 1 1.100 - - LDO PTHR13393
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4658
SonicParanoid 1 1.000 - - X3398
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.