DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and ZFX

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001317256.1 Gene:ZFX / 7543 HGNCID:12869 Length:844 Species:Homo sapiens


Alignment Length:392 Identity:83/392 - (21%)
Similarity:136/392 - (34%) Gaps:79/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 CYKCENLPWKKL---QDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSH-IIRKSTSSRELHENK 231
            |..|:....||:   ..:|.|:.|.:......|..|.:.|....:|.:| ::.|...:.::|:.|
Human   497 CTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCK 561

  Fly   232 RYKRLLENQKSQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLS------KCP 290
            ..:.....|.......|.:.......|.|...:..        :||.:.:|...:.      :|.
Human   562 FCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGF--------RHPSELKKHMRIHTGEKPYQCQ 618

  Fly   291 SCAQNYGFSFSHQLHM-VKHRRERLYTNFPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFK 354
            .|......|.:.:.|: .||.:|     .||.|..|..:|...|.:::|        .|:::..|
Human   619 YCEYRSADSSNLKTHVKTKHSKE-----MPFKCDICLLTFSDTKEVQQH--------ALIHQESK 670

  Fly   355 ---CPHCTWRFQLKSALDSHVLRIHERRKP--CLICKLPTSRLCCSAHTSKECNRAMQKYRDKMR 414
               |.||..:....|.|..|::.:|.:..|  |.:|..       ..|...|..:.:..::.|  
Human   671 THQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMCDK-------GFHRPSELKKHVAAHKGK-- 726

  Fly   415 PLREPPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRK 479
                         ....|:.|:.|....|.|..|:...|.....|.|:.|...|..|..::.|.|
Human   727 -------------KMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCRKGFRQQSELKKHMK 778

  Fly   480 AVHLLVHTVQCEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSNRR-----KGARTTD 539
             .|......|||.|:.:......::||..| .|             |||...|     ||.|...
Human   779 -THSGRKVYQCEYCEYSTTDASGFKRHVIS-IH-------------TKDYPHRCEYCKKGFRRPS 828

  Fly   540 EK 541
            ||
Human   829 EK 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/20 (20%)
C2H2 Zn finger 322..343 CDD:275368 5/20 (25%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 6/20 (30%)
C2H2 Zn finger 461..486 CDD:275368 7/24 (29%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
ZFXNP_001317256.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.