DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and Zfp276

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:XP_006531290.1 Gene:Zfp276 / 57247 MGIID:1888495 Length:669 Species:Mus musculus


Alignment Length:287 Identity:62/287 - (21%)
Similarity:101/287 - (35%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLSKCPSCAQNYGFSFSHQLHM 306
            |::|.:.:.:....::...|..|...|..|.|.:. .::.:...:.|.|.....:       ...
Mouse   366 SEDESDKKQTPQSSDESFEPYPEKKVSGKKSEGRE-AKRPEEPKIRKKPGPKPGW-------KKK 422

  Fly   307 VKHRRERLYTNFPFHCSFCNRSFL----TRKFLRKHQQRVRTFSTLLYRPFKCPH--CTWRFQLK 365
            ::..||.|.|.:......|...:.    .:|.:::|.:.||.      ||  |||  |...|.:.
Mouse   423 LRCEREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRE------RP--CPHPGCNKVFMID 479

  Fly   366 SALDSHVLRIHERRKPCLICKLPTS------RLCCSAHTSKECNR-AMQKYRDKMRP-------- 415
            ..|..||..||...:.|:....|:|      ....:|||:....| |:.......||        
Mouse   480 RYLQRHVKLIHTGPRCCVKQWSPSSPGADWASAVAAAHTALLLQRSAITSVTSAGRPSSSGSTFS 544

  Fly   416 -----LREPPKGGCRK----------------QPTPV-CKICNRKFTRKFFLEEHMNKAHL-NKR 457
                 .|||  ..|.|                .|.|. |::|..:..::..|:.||.|... .:.
Mouse   545 STRCATREP--SHCSKCGLGTACDWDKCSLPHLPLPSRCEVCGFQCRQRASLKYHMTKHKAETEL 607

  Fly   458 NFTCEICGANFYSQGTMQTHRKAVHLL 484
            :|.|:.||..|.....:..|...||.|
Mouse   608 DFACDQCGRRFEKAHNLNVHMSMVHPL 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 1/19 (5%)
C2H2 Zn finger 322..343 CDD:275368 3/24 (13%)
C2H2 Zn finger 355..376 CDD:275368 8/22 (36%)
C2H2 Zn finger 432..453 CDD:275368 6/20 (30%)
C2H2 Zn finger 461..486 CDD:275368 8/24 (33%)
C2H2 Zn finger 490..506 CDD:275368
Zfp276XP_006531290.1 zf-AD 80..156 CDD:214871
SFP1 <321..476 CDD:227516 24/125 (19%)
C2H2 Zn finger 581..601 CDD:275368 5/19 (26%)
C2H2 Zn finger 611..632 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.