DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and ZIPIC

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:540 Identity:104/540 - (19%)
Similarity:173/540 - (32%) Gaps:197/540 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KCCRGFREKYVAFNGEGETIFGTDFSSELCED-VQKIMRFRSS---------DMLLLLRTAQLRD 93
            :|.||  ..||.          |:.||.:|:. .:|:.|:..|         ::|.|:.:..:..
  Fly    34 QCTRG--TNYVL----------TEESSTICKKCCEKLARYHKSIQIARKLRGEILELIHSPYMSK 86

  Fly    94 NFWTNEYFKADLQDDFRA------IFDAFEEKNRKVQLEKLAAILDTVS-SGYRRSVSQLAGQEA 151
            :.....|.:.||..:...      |.:|.::...:.:||.:...:..|. :|....|::      
  Fly    87 DHKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAE------ 145

  Fly   152 HGALRPKIAALFLPGLRCDCYKCENLPWKKLQDVEDHQ---KTHRYSDNFHCQICYRRFYLQHSL 213
                                              |:|.   |.....|.||      ...|:..:
  Fly   146 ----------------------------------EEHTFIIKQSEEEDEFH------SVDLELDI 170

  Fly   214 TSHIIRKSTSSREL----HENKRYKRLLE--------NQKSQEE---KELELS-----LNKVEDI 258
            .:.||.....:.|:    ||.:.....:|        .|::|||   ||..:|     |:...:.
  Fly   171 DNEIIINEEEAHEVEEVAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGAIEY 235

  Fly   259 LVPVAEDLQSYFKDESKHPIQKRKTSSLSKCPSCAQNYGFSFSHQLHMVKHRRERL--------- 314
            ::...||.:...:...::.:.       .:||||.:.:.   |.:.:.|..:||..         
  Fly   236 IISDGEDQEQDNESSGEYTVN-------IQCPSCPEKFS---SRRAYNVHTKREHFPGYVCDQCG 290

  Fly   315 -----YTNF-----------PFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQ 363
                 |:.|           .|.|..|...| :|||..||.....:..|    |::|..|:.||.
  Fly   291 KTLQSYSGFIGHLQNHEPVKQFACPVCPERF-SRKFRLKHHMAWHSGET----PYQCDVCSKRFV 350

  Fly   364 LKSALDSHVLRIHERRKPCLICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGGCRKQP 428
            .|.||..|.: ||:..         |.||                                    
  Fly   351 HKVALYKHKM-IHDSE---------TKRL------------------------------------ 369

  Fly   429 TPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKA-------VHLLVH 486
              .|::|..|...|..||.|| ::|...:.|.|.:|...|.....|:.|.:.       .|...|
  Fly   370 --ECQVCGFKTRTKAHLERHM-RSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPGTNRHRRFH 431

  Fly   487 TVQCEVCDLTIKSKGNYRRH 506
               |..|..|..::.||..|
  Fly   432 ---CSKCTHTFINEQNYDAH 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 322..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 432..453 CDD:275368 8/20 (40%)
C2H2 Zn finger 461..486 CDD:275368 6/31 (19%)
C2H2 Zn finger 490..506 CDD:275368 5/15 (33%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 8/20 (40%)
zf-H2C2_2 327..351 CDD:290200 8/27 (30%)
C2H2 Zn finger 342..391 CDD:275368 21/97 (22%)
zf-H2C2_2 383..408 CDD:290200 9/25 (36%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
C2H2 Zn finger 432..449 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.