DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG1647

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:720 Identity:126/720 - (17%)
Similarity:213/720 - (29%) Gaps:290/720 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGK--LLVTYENFTTDL--PVLS-------------IDKKPYGCPASCHCKCKCCRGFREKYVAF 51
            |||  :|:..|..|.||  |.:|             .||.|....:.|..|......|||...|.
  Fly    28 PGKVPILLPNEEDTIDLDEPRMSQKIYELVGFTVSVDDKMPQTICSQCVDKINDFYEFREMCYAT 92

  Fly    52 NGEGETIFGTDFSSELCEDVQKIMRFRSSDMLLLLRTAQLRDNFWTNEYFKADLQDDFRAIFDAF 116
            |.:...:.|                      |..:..|:|.|       .|..:::: |.|..|.
  Fly    93 NKQTRNLLG----------------------LKQIEPARLID-------LKRIVKEE-RPISGAV 127

  Fly   117 EEKNRKVQLEKLAAILDTVSSGYRRSVSQLAGQEA---HGALRPKIAALFLPGLRCDCYKCENLP 178
            .::.||.:                       |:|:   :..::|::             |.|:..
  Fly   128 GKRGRKRK-----------------------GEESWPKNNNVKPQV-------------KKESFV 156

  Fly   179 WKKLQDVEDHQKTHRYSD-------------------------NFHCQICYRRFYLQHSLTSHII 218
            |.|.|.::..|.|...|.                         ...|.:|..:|.          
  Fly   157 WHKKQKLQPSQITSLVSKREPEIKDEPAEQDTSLKGPPKKAGRKSICSVCGEKFL---------- 211

  Fly   219 RKSTSSRELHENKRYKRLLENQKSQEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKT 283
                 |:||              :.|.|.| :.:..:...:............|...|.:..:.:
  Fly   212 -----SKEL--------------ADEHKSL-VHVPSIPRYICNACNQTHHNQSDIRAHQLWHKLS 256

  Fly   284 SSLSKCPSCAQNYGFSFSHQLHMVKHR-----------RERLYTNFPFHCSFCNRSFLTRKFLRK 337
            .:..|||.|..:...:::...|:.:|.           ||         |..|.::|:|..|...
  Fly   257 KTPYKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRE---------CPLCKKTFVTNFFYNT 312

  Fly   338 HQQRV---------RTFST----LLYRPFKCP-----HCTW----------RFQLKSALDSHVLR 374
            |:..:         ||.:|    :.:.| .||     |...          :..:|:.::..:|.
  Fly   313 HRCAIRKRKCGGCSRTLNTEAAYMRHAP-TCPKIYLNHSKHIMPQVVTNEAQMLIKNEIEEELLG 376

  Fly   375 ------------IHERRKPCLICKLPTSRLCCS--------AHTSKECNR-AMQKYRDKMRPLRE 418
                        |.|..:|.::.:..:|.|..|        |..||..:| :.:.|..::..|.:
  Fly   377 LPPATTVPPDFVIDEGMQPVVVLERLSSPLLRSSSGTDQLVAAKSKNSDRVSARNYLKRVDQLLK 441

  Fly   419 ---------------------PPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKA-HLNKRNFTC 461
                                 ||:|.....|.|     .|.       |||.:.. .:...|..|
  Fly   442 NTINTLVSIKHEPEVHINDTGPPRGQAESDPEP-----ERN-------EEHPSFGDDIQAANDEC 494

  Fly   462 EICGANFYSQGTMQTHRKAVHLLVHTVQCEVCD----LTIKSKGNYRRHCKSQSHKDNLVKF--- 519
            :.|.....|.               .:....||    :::|.:..|..:.|....|...:|.   
  Fly   495 QECQPETESD---------------KISVAACDDIPSVSVKQEPEYDGYEKQTGVKQEPLKLKLK 544

  Fly   520 -----GKNNDKTKD-----------SNRRKGARTTDEKLDIEASSSTNTCMTSANKSTHNYKKMG 568
                 ||.|....|           |:::|..|...|: :.|||:.|..|.|.:.      .:..
  Fly   545 ITKNHGKLNSSLIDDLDEAGQAFGRSSKKKKKRKHKER-EKEASNETENCRTESQ------NQPA 602

  Fly   569 IKTKQ 573
            ||.||
  Fly   603 IKIKQ 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 322..343 CDD:275368 6/29 (21%)
C2H2 Zn finger 355..376 CDD:275368 5/47 (11%)
C2H2 Zn finger 432..453 CDD:275368 4/21 (19%)
C2H2 Zn finger 461..486 CDD:275368 3/24 (13%)
C2H2 Zn finger 490..506 CDD:275368 4/19 (21%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 20/70 (29%)
C2H2 Zn finger 203..224 CDD:275368 9/50 (18%)
C2H2 Zn finger 233..253 CDD:275368 2/19 (11%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
C2H2 Zn finger 297..314 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.