DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG6791

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:625 Identity:107/625 - (17%)
Similarity:184/625 - (29%) Gaps:246/625 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 CYKCENLPWKK--LQDVEDHQKTH-RYSDNFHCQICYRRFYLQHSLTSHIIRKSTSSRELHENKR 232
            |.:|:.:....  :|:.:.|:.|| .:.....|:.|::.:..:..|..|:        ..|....
  Fly   557 CTECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHL--------ATHHRVG 613

  Fly   233 YKRLLE--------NQKSQEEKELELSLNKVEDILV-------------PVAEDLQSYFKDESKH 276
            :.|.|.        ....|..|::....|:..:|:.             ...|.:|:   :|.::
  Fly   614 WPRKLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQA---EEDEY 675

  Fly   277 PI---------------------------------------------------QKRKTSSLSK-- 288
            ||                                                   ::|:...:|.  
  Fly   676 PIAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSAD 740

  Fly   289 -------------CPSCAQNYGFSFSHQLHMVKHRRE------RLYTN------FPFHCSFCNRS 328
                         ||||    ||.:..|....:|..|      |.|.|      :.:.|:.|...
  Fly   741 PSVPTVEQNYIFLCPSC----GFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQCKDI 801

  Fly   329 FLTRKF--LRKHQQRVRTFSTLLYRPF-KCPHCTWRFQLKSALDSHVLRIH---ERRKPCLICK- 386
            ....|.  |:.|.     |..|.||.: ||..|...:..|..:.:|:...|   :|..|.:|.| 
  Fly   802 VCNSKLKGLQDHH-----FRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMITKP 861

  Fly   387 -----------------------------LPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKG 422
                                         .|:...|.|:..:...:|::           :|..|
  Fly   862 KQVLGRYKDNSRENPKLPSPPPAPALAPAPPSPPACSSSAAASASSRSL-----------KPQPG 915

  Fly   423 GCRKQP---------------------TPVCKICNRKFT-----RKFFLEEH-------MNKAHL 454
            |...:|                     |..|..||:.|.     ||..:|:|       :|...:
  Fly   916 GLPARPAGLNTLEDSISYHNAVDLDFITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQI 980

  Fly   455 NKRNFTCEICGANFYSQ----------GTMQTHRKAVHLLVHTVQCEVCDLTIKSKGNYRRHCKS 509
            :..::.|..|    |.:          |.:|:| |..||...:.:|..|......|..:.:|.  
  Fly   981 DNHHYLCLEC----YKRVTVTHTKGAIGQLQSH-KFRHLPHRSFKCLTCGGEFVRKQMFFKHL-- 1038

  Fly   510 QSHKDNLVKFGKNNDKTKDSNR---RKGARTTDEKLDIEASSST---NTC-MTSANKSTHNYKKM 567
                            .:|:||   |......|::.|.:...||   .|| ....|..|||.|:.
  Fly  1039 ----------------NRDTNRCDNRPHREFDDDEPDQDTLLSTIYHLTCPQCGDNFKTHNKKEW 1087

  Fly   568 GIKTKQTH----LKTPCRSKKRVKIKICETCGNSIVGSMQ 603
            .......|    |:....:|....:..|:.|...:..:.|
  Fly  1088 REHINDHHGLTKLELLHMTKVGEDVYRCQDCDEELETNRQ 1127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 7/19 (37%)
C2H2 Zn finger 322..343 CDD:275368 5/22 (23%)
C2H2 Zn finger 355..376 CDD:275368 4/20 (20%)
C2H2 Zn finger 432..453 CDD:275368 9/32 (28%)
C2H2 Zn finger 461..486 CDD:275368 9/34 (26%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368 4/22 (18%)
C2H2 Zn finger 589..609 CDD:275368 4/27 (15%)
COG5236 <939..>1096 CDD:227561 38/179 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.