DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG14667

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:340 Identity:76/340 - (22%)
Similarity:120/340 - (35%) Gaps:88/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 CQICYRRFYLQHSLTSHIIRKSTSSRE--LHENKRYKRLLENQKSQEEKELELSLNKVEDILVPV 262
            |:.|:....|           :|..||  :...|....:::....|....:|||...:::.|:. 
  Fly    54 CERCFSELDL-----------ATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLID- 106

  Fly   263 AEDLQSYFKDE-------SKHPIQKRKTSSLSKCPS----CAQNYGFSFSHQLHMVKHRRERL-- 314
            |:.|::::.|:       :|...|..:...|...||    .|.......:.|..:.:...||.  
  Fly   107 ADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAK 171

  Fly   315 -YTNFPFHCSFC----NRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLR 374
             .:|| |.|..|    :.:||..:.|..||.| |..:..    |.||.|...|..|:.|..|..:
  Fly   172 RRSNF-FICDECGTLFHDAFLYTEHLNGHQNR-RDMNQF----FPCPECPQTFNKKALLKQHRTQ 230

  Fly   375 IHERRKPCLICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKICNRKF 439
            :|      ||                  ||..|                        |.||:..|
  Fly   231 VH------LI------------------NRRFQ------------------------CTICHEAF 247

  Fly   440 TRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLVHTVQCEVCDLTIKSKGNYR 504
            ........| :|||.|:|.:.|..||..|.|...:|.|.......:...:||.|::...::....
  Fly   248 ASLGAKLRH-DKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLV 311

  Fly   505 RHCKSQSHKDNLVKF 519
            .|.|:..|| .|.|:
  Fly   312 AHTKTAPHK-RLAKY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/23 (17%)
C2H2 Zn finger 322..343 CDD:275368 8/24 (33%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 432..453 CDD:275368 6/20 (30%)
C2H2 Zn finger 461..486 CDD:275368 7/24 (29%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 7/36 (19%)
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 6/20 (30%)
zf-C2H2_8 243..313 CDD:292531 18/70 (26%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..316 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.