DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG10654

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:398 Identity:89/398 - (22%)
Similarity:141/398 - (35%) Gaps:94/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GQEAHGALRPKIAALFLPGLRCDCYKCENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRF--YLQ 210
            |::|...|.|::....:    |:|  |..|    :|...|.|:.        |....|.|  .||
  Fly    71 GEDAVRDLPPQLVLKSI----CEC--CYQL----VQKFHDFQRM--------CAESLRNFEKLLQ 117

  Fly   211 ------HSLTSHIIRKSTSSRELHENKRYKRLLENQKSQEEKELELSLNKV-----EDILVPVA- 263
                  |.|..|......:..|.:|:       .|.::|.......:..::     ..:.:|:| 
  Fly   118 DIDIGCHKLEDHTWHDLDTPSESNES-------TNPEAQSHAPCIAATQEIVSFIWPQVCLPLAV 175

  Fly   264 -----------EDLQSYFKDES-KHPIQKRKTSSLSKCPSCAQNYGFSFSHQLHMVKHRRERLYT 316
                       |:.....:||| |..:.:.|.|..||.....:..|         |:|..|    
  Fly   176 ILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRG---------VRHTLE---- 227

  Fly   317 NFPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLRIHERRKP 381
                 |..|:|.|.....|..|.|:....     ||:.|.||...:...:.|:||:.::|.....
  Fly   228 -----CRICHRGFYKPSLLEAHMQQHEGL-----RPYTCVHCAKSYARANLLESHLRQMHNNADA 282

  Fly   382 C-LICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKICNRKFTRKFFL 445
            . :|...|:   |...:|:   ||:: ||.  ||...|............:|:.|.:.|.||..|
  Fly   283 ARIIYACPS---CNKVYTA---NRSL-KYH--MRRTHERYHESESPDARHICEECGKCFARKAHL 338

  Fly   446 EEH-MNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVH----LLVHTVQCEVCDLTIKSKGNYRR 505
            ..| |....:..|.:.||.|...||::..|..|....|    ||   ::|..|....::......
  Fly   339 TRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKHGNKNLL---LRCRKCGRIFQNSVELNA 400

  Fly   506 HCKSQSHK 513
            |  .:.||
  Fly   401 H--GRKHK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 2/19 (11%)
C2H2 Zn finger 322..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 8/21 (38%)
C2H2 Zn finger 461..486 CDD:275368 10/28 (36%)
C2H2 Zn finger 490..506 CDD:275368 2/15 (13%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 14/61 (23%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 18/65 (28%)
C2H2 Zn finger 289..314 CDD:275368 10/33 (30%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.