DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG1602

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster


Alignment Length:458 Identity:104/458 - (22%)
Similarity:182/458 - (39%) Gaps:101/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DAFEEKNRKVQLEKLAAILD-TVSSGYRRSVSQLAGQEAH------------GALRPKIAALFLP 165
            |..|.|..|..|:::|..|: |||........:||.::.|            |..:|:..|..:.
  Fly   174 DYKEPKKCKEALKRMAIDLEATVSVFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIY 238

  Fly   166 GLRCDCYKCENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIRKSTSSRELHE- 229
            .|.|           .|....|.:..   ::|...::.:.:   ::.||:.:|....:..:|:: 
  Fly   239 KLCC-----------FLNASNDEEGA---TNNEKIKLDFSK---KNKLTTDLIEMYANFPQLYDS 286

  Fly   230 -NKRYKRLLENQKSQEEKELELSLNKVE---DILVPVAEDLQSYFKDESKHPIQKRKTSSLSKCP 290
             :|.:..:...:::.|....|:|:..|:   |.:....::|:.::...:||.|....|:......
  Fly   287 NHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLRQWYYKNTKHAIYAGSTAEKFYLE 351

  Fly   291 SC--------AQNYGFSFSHQL----HMVKHRRERLYT--NFPFHCSFCNRSFLTRKFLRKHQQR 341
            .|        .|.....|.||:    |:::....:.:.  ..||.|:.|:|||:.|..|..|.||
  Fly   352 VCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFVGRCELANHIQR 416

  Fly   342 VRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLRIHERRKPCLICKLPTSRLCCSAHTSKECNRAM 406
            |....|     .||.||...|.:.|.|..|: |.|...|| .:|              :.|.:|.
  Fly   417 VHIGKT-----HKCTHCERSFAVMSDLQLHI-RTHTGHKP-YVC--------------EHCGKAF 460

  Fly   407 Q----------KYRDKMRPLREPPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTC 461
            :          ....|:|..:              |.:|.:.|.:|..|.:|: |.|||.|:..|
  Fly   461 RLRSQMTLHVTAIHTKIRAFK--------------CTMCPKDFVKKVDLSDHI-KGHLNIRDKIC 510

  Fly   462 EICGANFYSQGTMQTHRKAVHLLVHTVQCEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKT 526
            .:||..|.|...:..||: :|..|....|::||...........|.| ::|  |:::  .|:.|.
  Fly   511 SVCGKGFTSCHALIRHRQ-IHSEVKKFVCKLCDSRFSQFVGLNTHMK-RTH--NILR--NNSQKG 569

  Fly   527 KDS 529
            ||:
  Fly   570 KDA 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 6/31 (19%)
C2H2 Zn finger 322..343 CDD:275368 10/20 (50%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 8/24 (33%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
CG1602NP_610291.2 GT1 157..244 CDD:304916 18/80 (23%)
MADF_DNA_bdg 273..356 CDD:287510 14/82 (17%)
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 10/20 (50%)
COG5048 <423..554 CDD:227381 40/162 (25%)
C2H2 Zn finger 425..445 CDD:275368 8/20 (40%)
zf-H2C2_2 437..460 CDD:290200 8/38 (21%)
C2H2 Zn finger 453..470 CDD:275368 3/30 (10%)
C2H2 Zn finger 482..502 CDD:275368 7/20 (35%)
C2H2 Zn finger 510..530 CDD:275368 7/20 (35%)
C2H2 Zn finger 538..559 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.