DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and az2

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:510 Identity:91/510 - (17%)
Similarity:161/510 - (31%) Gaps:178/510 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KCCRGFREKYVAFNGEGETIFGTDFSSELCEDVQKIMRFRSSDMLLLLRTAQLRD---------- 93
            ||......:|.:.:.:.:|           :.:.|:..:.......|.....|.|          
  Fly   207 KCITSLHAQYASISRQKKT-----------QKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDG 260

  Fly    94 ---------NFWTNEYFKADLQDDFRAIFDAFEEK--NRKVQLEKLAAILDTVSSGYRRSVSQLA 147
                     |..|.::.  ||...|..::|...:.  |..|:...|..|.|.::|.:  |:..:.
  Fly   261 KIKLVFTEENQLTTQFI--DLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEF--SLGLVT 321

  Fly   148 GQEAHGALRP-------KIAALFLPGLRCDCYKCENLPWKKLQDVE---DHQKTHRYSDNFHCQI 202
            ..:.:.:::.       :|..|       ...:|..|...:.|.:|   ....|..:.....|::
  Fly   322 HYDVYDSIQSMRQWYSRRIKTL-------TDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEV 379

  Fly   203 CYRRFYLQHSLTSHIIRKSTSSRELHENKRYKRLLENQKSQEEKELELSLNKVEDILVPVAEDLQ 267
            |...|...|:|.:|                                                   
  Fly   380 CEHSFSTDHALQAH--------------------------------------------------- 393

  Fly   268 SYFKDESKHPIQKRKTSSLSKCPSCAQNYGFSFSHQLHMVKHRRERLYTNFPFHCSFCNRSFLTR 332
             .|:|      .|.......:|..|..|    |..:.|:.:| .:|::.:..|.|..|:|||...
  Fly   394 -QFRD------HKMGDGGWFRCTLCELN----FDRKCHLQQH-SQRVHMDKSFVCEICSRSFAFG 446

  Fly   333 KFLRKHQQRVRTFSTL-LYRPFKCPHCTWRFQLKSALDSHVLRIHERRKPCLICKLPTSRLCCSA 396
            ..|..|:   ||.... :.:||.|..|...|:.|..:.:||..:|                    
  Fly   447 NQLAIHK---RTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVH-------------------- 488

  Fly   397 HTSKECNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTC 461
                          .|:|..:              |.:|.:.|..|..|::|: |||||.|:..|
  Fly   489 --------------TKIRAFK--------------CDMCPKDFLTKRDLKDHV-KAHLNIRDKVC 524

  Fly   462 EICGANFYSQGTMQTHRKAVHLLVH---TVQCEVCDLTIKSKGNYRRHCKSQSHK 513
            |:|...|.:...:..||.     :|   |:||.:|......:.:...|.: ::||
  Fly   525 EVCQKAFTNANALVKHRH-----IHKEKTLQCSLCTTRFSERVSLGVHMR-RTHK 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
C2H2 Zn finger 322..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 6/24 (25%)
C2H2 Zn finger 490..506 CDD:275368 2/15 (13%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 5/45 (11%)
GT1 276..>341 CDD:304916 11/68 (16%)
C2H2 Zn finger 377..398 CDD:275368 8/78 (10%)
C2H2 Zn finger 408..429 CDD:275368 7/25 (28%)
C2H2 Zn finger 436..456 CDD:275368 8/22 (36%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 7/20 (35%)
C2H2 Zn finger 524..544 CDD:275368 6/24 (25%)
C2H2 Zn finger 551..572 CDD:275368 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.