DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG2129

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:541 Identity:111/541 - (20%)
Similarity:182/541 - (33%) Gaps:183/541 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LPGLRCDCY------KCENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIRKST 222
            |..|:.|.|      ||..:.::.|           :|....|..|..:.::......|:     
  Fly     2 LKSLKPDTYAGMANAKCGEIYFQSL-----------HSFRIDCAFCEMKSFVFGDFLLHV----- 50

  Fly   223 SSRELH-ENKRYKRLLENQKS------QEEKELELSLNKVEDILVPV---------------AED 265
              :.:| ||    .||:.:.:      ::|::.|...|....|:..|               ::|
  Fly    51 --QNIHFEN----GLLKTEATDAGANLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSDD 109

  Fly   266 ----LQSYFKDESKHP---------IQKRKTSSLSKCPSCAQNYGFSFSHQ----LHMVKHRRER 313
                |:...:||.:.|         .|...:.||.:..:...:|....|.|    :.:......|
  Fly   110 ERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMELDLDSEGR 174

  Fly   314 LYTNFPFHCSFCNRSFLTRKFLRKH--QQRVRTFSTLL------YRP------------FKCPHC 358
            .....|..|..|.:.:.:||.|.:|  :|...|.|..:      |.|            :||.||
  Fly   175 HSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHC 239

  Fly   359 TWRFQLKSALDSHVLRIHERRK-------PCLIC--KLPTSRL----CCSAHTSKECNRAMQKYR 410
            ...:..|.:|..|:.|.|:..:       .||.|  :||..||    ...||....|....::|:
  Fly   240 GKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYK 304

  Fly   411 DKMRPLREPPKGGCRKQ---PTPVCKICNRKFTRKFFLEEHM---NKAHLNKRNFTCEICGANFY 469
            .:....|...|....:.   |.|.|       .::||...||   .|.|..::||.||.||   |
  Fly   305 TRHELKRHQLKHTSERNVPCPHPGC-------GKRFFTIRHMRNHGKVHTEQKNFVCESCG---Y 359

  Fly   470 SQGTMQTHRKAVHLLVHTVQ----CEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSN 530
            |....:|.|  ||:..||.:    |:|||....|....|.|                        
  Fly   360 SCRNKETLR--VHIRSHTGERPFGCQVCDKRFPSHSGLREH------------------------ 398

  Fly   531 RRKGARTTDEKLDIEASSSTNTCMT-----SANKSTHNYKKMGIKTKQTHLKTPCRSKKRVKIKI 590
                       :.:.::...:.|..     |..|..:::|.:...|||.               :
  Fly   399 -----------MAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQF---------------V 437

  Fly   591 CETCGNS------IVGSMQRH 605
            |:.|||:      :.|.|::|
  Fly   438 CKLCGNAYAQAAGLAGHMRKH 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 3/23 (13%)
C2H2 Zn finger 322..343 CDD:275368 7/22 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 432..453 CDD:275368 6/23 (26%)
C2H2 Zn finger 461..486 CDD:275368 10/24 (42%)
C2H2 Zn finger 490..506 CDD:275368 6/15 (40%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 3/19 (16%)
zf-C2H2_8 323..411 CDD:292531 30/134 (22%)
C2H2 Zn finger 327..346 CDD:275368 7/25 (28%)
C2H2 Zn finger 354..374 CDD:275368 10/24 (42%)
zf-H2C2_2 367..389 CDD:290200 9/23 (39%)
C2H2 Zn finger 382..402 CDD:275368 7/54 (13%)
zf-H2C2_2 395..419 CDD:290200 3/58 (5%)
C2H2 Zn finger 410..430 CDD:275368 4/19 (21%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.