DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and CG12219

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:508 Identity:88/508 - (17%)
Similarity:142/508 - (27%) Gaps:183/508 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NFW-TNEYFKADLQDDFRAIFDA---FEEKNRKVQLEKLAAILDTVSSGYRRSVSQLAGQEAHGA 154
            ||| ..|..:..|...|.|| |.   :.|...:.||:....:|             |...|....
  Fly    79 NFWKLVELKQTTLCSQFLAI-DCDVNWSEDGSETQLDAQPQLL-------------LEPAEEPKV 129

  Fly   155 LRPKIAALFLPGLRCDCYKCENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIR 219
            :.|..|..|      .|..||. .:|..:.:|:|..||.......|..|...|..:.::.:|:..
  Fly   130 VTPTTANKF------PCMFCEK-SFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHVKS 187

  Fly   220 KSTSS-RELHENKRYKRLLENQKSQEEKELELSLNKVEDILVPV--------AEDLQSYFKDESK 275
            |.|:. .:..|.:...:..:|..:.||        ....:||||        :....|.....:.
  Fly   188 KHTTQWLKAREERDAAKSNQNHTTPEE--------TAPAVLVPVPAPAPALASAPASSASPGNTV 244

  Fly   276 HP--------------------------IQKRKTSSLSKCPSCAQNYGFS--------------- 299
            :|                          :|:...|.:...||.|.|...:               
  Fly   245 NPAATATPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKTPPSGSRGSRNRSS 309

  Fly   300 --FSHQLHMVKH-----------------RRERLYTNF-----------------PFHCSFCNRS 328
              .:|....|:|                 ..|.:..|:                 |.......:.
  Fly   310 RRKTHSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLTGNPPGQPDSLQQR 374

  Fly   329 FLTRKFLRKHQQRV------------------------RTFSTLLYRPFKCPHCTWRFQLKSALD 369
            .......::||:::                        .|..|::..|:               .
  Fly   375 LCASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPY---------------G 424

  Fly   370 SHVLRIHERRK----PCLICKLPTSRLCCSAHTSKECNRAM-QKYRDKMRPLREPPKGGCRKQPT 429
            :|.....::|.    ..:|...|.|.:|      ..|.... |.:|             |..:|.
  Fly   425 NHPPSETDKRPAAPLQAVIHAAPVSIIC------PNCGELPGQNHR-------------CLSKPK 470

  Fly   430 PVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVH 482
            ..|.:|.:.|..|.:||||. ..|...:..||..|...|.|:..|..|.|..|
  Fly   471 YACDVCGKSFKMKRYLEEHF-ATHTGVKLHTCAFCPTEFRSKSNMYHHTKRKH 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 6/36 (17%)
C2H2 Zn finger 322..343 CDD:275368 2/44 (5%)
C2H2 Zn finger 355..376 CDD:275368 1/20 (5%)
C2H2 Zn finger 432..453 CDD:275368 8/20 (40%)
C2H2 Zn finger 461..486 CDD:275368 8/22 (36%)
C2H2 Zn finger 490..506 CDD:275368
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 5/14 (36%)
C2H2 Zn finger 140..160 CDD:275368 6/20 (30%)
COG4049 149..204 CDD:226535 11/54 (20%)
C2H2 Zn finger 168..186 CDD:275368 4/17 (24%)
C2H2 Zn finger 473..493 CDD:275370 8/20 (40%)
C2H2 Zn finger 501..522 CDD:275370 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.