DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and Bnc2

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:XP_017175693.1 Gene:Bnc2 / 242509 MGIID:2443805 Length:1156 Species:Mus musculus


Alignment Length:206 Identity:53/206 - (25%)
Similarity:75/206 - (36%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 SAHTSKECNRAMQK------YRDKMRPLR---------EPPKGGCRKQPTPVCKICNRKFTRKFF 444
            |..|..|.|.:.:.      |:....|.|         ||     :.:|..|..|.|........
Mouse   391 SISTQNEYNESSESEVSPTPYKSDQTPNRNALTSITNVEP-----KTEPACVSPIQNSAPVSDLS 450

  Fly   445 LEEH------------MNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLV-HTVQCEVCDLT 496
            ..||            |..|....|.| |..||..||.:||::.|..||||.: |....|.|::.
Mouse   451 KTEHPKSSFRIHRMRRMGSASRKGRVF-CNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMV 514

  Fly   497 IKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSNR-RKGARTTDEKLDIEASSSTNTCMTSANKS 560
            ..|..:..||..:.:.:.::.....|.|  ||..| ..||.|     .:.||:.:|..:||..: 
Mouse   515 FSSLRSRNRHSANPNPRLHMPMLRNNRD--KDLIRATSGAAT-----PVIASTKSNLTLTSPGR- 571

  Fly   561 THNYKKMGIKT 571
                ..||..|
Mouse   572 ----PPMGFTT 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 322..343 CDD:275368
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 432..453 CDD:275368 5/32 (16%)
C2H2 Zn finger 461..486 CDD:275368 12/25 (48%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
Bnc2XP_017175693.1 C2H2 Zn finger 478..499 CDD:275368 9/20 (45%)
C2H2 Zn finger 506..524 CDD:275368 3/17 (18%)
C2H2 Zn finger 1094..1115 CDD:275368
C2H2 Zn finger 1122..1140 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7987
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.