Sequence 1: | NP_611014.1 | Gene: | CG8089 / 36679 | FlyBaseID: | FBgn0033993 | Length: | 624 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017175693.1 | Gene: | Bnc2 / 242509 | MGIID: | 2443805 | Length: | 1156 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 75/206 - (36%) | Gaps: | 47/206 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 395 SAHTSKECNRAMQK------YRDKMRPLR---------EPPKGGCRKQPTPVCKICNRKFTRKFF 444
Fly 445 LEEH------------MNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLV-HTVQCEVCDLT 496
Fly 497 IKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSNR-RKGARTTDEKLDIEASSSTNTCMTSANKS 560
Fly 561 THNYKKMGIKT 571 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8089 | NP_611014.1 | C2H2 Zn finger | 289..309 | CDD:275368 | |
C2H2 Zn finger | 322..343 | CDD:275368 | |||
C2H2 Zn finger | 355..376 | CDD:275368 | |||
C2H2 Zn finger | 432..453 | CDD:275368 | 5/32 (16%) | ||
C2H2 Zn finger | 461..486 | CDD:275368 | 12/25 (48%) | ||
C2H2 Zn finger | 490..506 | CDD:275368 | 3/15 (20%) | ||
Bnc2 | XP_017175693.1 | C2H2 Zn finger | 478..499 | CDD:275368 | 9/20 (45%) |
C2H2 Zn finger | 506..524 | CDD:275368 | 3/17 (18%) | ||
C2H2 Zn finger | 1094..1115 | CDD:275368 | |||
C2H2 Zn finger | 1122..1140 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7987 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |