DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and ZNF497

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001193938.1 Gene:ZNF497 / 162968 HGNCID:23714 Length:498 Species:Homo sapiens


Alignment Length:373 Identity:98/373 - (26%)
Similarity:143/373 - (38%) Gaps:88/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RSVSQLA-GQEAHGALRPKIAALFLPGLRC-DCYKCENLPWKKLQDVEDHQKTHRYSDNFHCQIC 203
            |:.|||. .||.|..|:|         .|| ||.|    .:.:...:..|::||.....:.|..|
Human   172 RAHSQLIHHQETHSGLKP---------FRCPDCGK----SFGRSTTLVQHRRTHTGEKPYECPEC 223

  Fly   204 YRRFYLQHSLTSHIIRKSTSSRELHENKRYKRLLENQKSQEEKELELSLNKVEDILV-----PVA 263
            .:.|....:...|        |.:|...|.....:..|:..:     |.|..|.:.:     |.|
Human   224 GKAFSWNSNFLEH--------RRVHTGARPHACRDCGKAFSQ-----SSNLAEHLKIHAGARPHA 275

  Fly   264 EDLQSYFKDESKHPI------QKRKTSSLSK---CPSCAQNYGFSFSHQL--HMVKHRRERLYTN 317
                  ..|..|..:      |.|:|.|..|   |..|.:  .|..|.||  |...|..||    
Human   276 ------CPDCGKAFVRVAGLRQHRRTHSSEKPFPCAECGK--AFRESSQLLQHQRTHTGER---- 328

  Fly   318 FPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLRIHERRKP- 381
             ||.|:.|.::|:...:|.:| :||.|..    :|..|..|...|..:|.|.|| .|.|...|| 
Human   329 -PFECAECGQAFVMGSYLAEH-RRVHTGE----KPHACAQCGKAFSQRSNLLSH-RRTHSGAKPF 386

  Fly   382 -CLIC--------KLPTSRLCCSAHTSK------ECNRAMQKYRDKMRPLREPPKGGCRKQPTPV 431
             |..|        .|...||   :||.:      ||.:|.:...:    ||:..:....::|. |
Human   387 ACADCGKAFRGSSGLAHHRL---SHTGERPFACAECGKAFRGSSE----LRQHQRLHSGERPF-V 443

  Fly   432 CKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRK 479
            |..|::.|.||..|..| .:.|..:|.:.|..||..|..:..:..|:|
Human   444 CAHCSKAFVRKSELLSH-RRTHTGERPYACGECGKPFSHRCNLNEHQK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 7/21 (33%)
C2H2 Zn finger 322..343 CDD:275368 6/20 (30%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 6/19 (32%)
C2H2 Zn finger 490..506 CDD:275368
ZNF497NP_001193938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..104
COG5048 107..492 CDD:227381 98/373 (26%)
C2H2 Zn finger 108..128 CDD:275368
zf-H2C2_2 120..144 CDD:290200
C2H2 Zn finger 136..156 CDD:275368
zf-H2C2_2 148..171 CDD:290200
C2H2 Zn finger 164..184 CDD:275368 6/11 (55%)
zf-C2H2 190..212 CDD:278523 6/25 (24%)
C2H2 Zn finger 192..212 CDD:275368 5/23 (22%)
zf-H2C2_2 205..228 CDD:290200 5/22 (23%)
C2H2 Zn finger 220..240 CDD:275368 5/27 (19%)
C2H2 Zn finger 248..268 CDD:275368 4/24 (17%)
C2H2 Zn finger 276..296 CDD:275368 4/19 (21%)
zf-H2C2_2 289..311 CDD:290200 7/23 (30%)
C2H2 Zn finger 304..324 CDD:275368 7/21 (33%)
zf-H2C2_2 317..340 CDD:290200 9/27 (33%)
C2H2 Zn finger 332..352 CDD:275368 6/20 (30%)
zf-H2C2_2 344..369 CDD:290200 9/29 (31%)
C2H2 Zn finger 360..380 CDD:275368 8/20 (40%)
C2H2 Zn finger 388..408 CDD:275368 5/22 (23%)
C2H2 Zn finger 416..436 CDD:275368 5/23 (22%)
zf-H2C2_2 428..453 CDD:290200 7/29 (24%)
C2H2 Zn finger 444..464 CDD:275368 7/20 (35%)
zf-H2C2_2 456..481 CDD:290200 8/25 (32%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.