DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and si:dkeyp-2e4.2

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001122042.1 Gene:si:dkeyp-2e4.2 / 100149164 ZFINID:ZDB-GENE-030131-9307 Length:251 Species:Danio rerio


Alignment Length:278 Identity:64/278 - (23%)
Similarity:114/278 - (41%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 KRLLENQKS-QEEKELELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLSK--------- 288
            |.:::|::| |.:.|.:.:.|.||.:::...|...:.|....|:.::..:||..|.         
Zfish     2 KPVIKNEESLQGDPESKSTNNDVETLVLSKTEGSAALFCRRLKYRVKTDQTSDQSSSDTDTEDEL 66

  Fly   289 -------------CPSCAQNYGFSFSHQLHMVKHRRERLYT-NFPFHCSFCNRSFLTRKFLRKH- 338
                         |..|...:|.:.|    ||:|.  |::| ..|:.|..|.:.|..:.:|::| 
Zfish    67 PISTSPTPGEDLICKLCGSEFGSNIS----MVRHM--RIHTGETPYICEVCGKGFKRQGWLKEHF 125

  Fly   339 -----QQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLRIHERRKP--CLICKLPTSRLCCSA 396
                 .:|.|.      :...|..|..:|...:||.|| |..|...:|  |:             
Zfish   126 RVHTGNKRKRE------KRLSCDQCEMKFNSSTALRSH-LNKHRGERPFACV------------- 170

  Fly   397 HTSKECNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTC 461
                :|::......|..:.||:     |.......|.:|..:|||:..|::|| :.|..:|.::|
Zfish   171 ----QCDKTYFNQHDLNQHLRD-----CHSDKKHGCYLCGNEFTRQSSLQKHM-RIHTGERPYSC 225

  Fly   462 EICGANFYSQGTMQTHRK 479
            ..||..|..:.:|:.|.|
Zfish   226 PHCGKTFSYKHSMKMHVK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 322..343 CDD:275368 6/26 (23%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 432..453 CDD:275368 8/20 (40%)
C2H2 Zn finger 461..486 CDD:275368 7/19 (37%)
C2H2 Zn finger 490..506 CDD:275368
si:dkeyp-2e4.2NP_001122042.1 C2H2 Zn finger 80..100 CDD:275368 8/25 (32%)
zf-H2C2_2 92..117 CDD:290200 10/30 (33%)
C2H2 Zn finger 108..128 CDD:275368 5/19 (26%)
C2H2 Zn finger 141..161 CDD:275368 8/20 (40%)
C2H2 Zn finger 169..217 CDD:275368 14/70 (20%)
zf-H2C2_2 209..234 CDD:290200 9/25 (36%)
C2H2 Zn finger 225..243 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.