DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8089 and Zbtb48

DIOPT Version :9

Sequence 1:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster
Sequence 2:XP_017175372.1 Gene:Zbtb48 / 100090 MGIID:2140248 Length:767 Species:Mus musculus


Alignment Length:518 Identity:99/518 - (19%)
Similarity:165/518 - (31%) Gaps:231/518 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 ENQKSQEEKE-----------LELSLNKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLSK--- 288
            |:::|::.||           |:...|:.| ::|.|.:|....:..|.:..:.:||:..:.|   
Mouse   226 EDKESEDCKEPPRPFEAGGAPLQGESNEWE-VVVQVEDDRDGDYVSEPETVLTRRKSKVIRKPCA 289

  Fly   289 --------------------------CPSCAQNYGFSFSHQLHMVKHRRERLYTNFPFHCSFCNR 327
                                      ||:|.:.:...:..::|..||..|:     ||.|..|.:
Mouse   290 AEPALGAGSLTAEPTDSRKGAAVPVECPTCHKKFLSKYYLKVHNRKHTGEK-----PFECPKCGK 349

  Fly   328 SFLTRKFLRKHQQR--------VRTFS----TLLYR--------------PFKCPHCTWRFQLKS 366
            .:..::.|.:|:.|        |.|.|    |...|              |:||..|:.:|..|.
Mouse   350 CYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKK 414

  Fly   367 ALDSHVLRIHERRKP-------------------------------------------CL----- 383
            .|.||::::|...||                                           ||     
Mouse   415 DLQSHMIKLHGAPKPHAVSASQGWGSGGSGTAQSCPHLDVLPLPVSPTCSAPLVPSASCLGRSYS 479

  Fly   384 ------------IC--------------------------------------KLPTSRLCCSAHT 398
                        :|                                      :.||| .|..|||
Mouse   480 CTRLLSIVEKSSLCVRNAGTGPRAATDCRCTSRPSTGMKGLMSVSSAAMPSPRRPTS-TCTCAHT 543

  Fly   399 -SKECNRAMQKYR---DKMR---PLREPPKGGCRKQP-----TPV-----------------CKI 434
             ::..:.|....|   .|:|   ||..|   |.| ||     :|:                 |:.
Mouse   544 PARSLSSATSVGRPSAPKVRQAQPLLAP---GLR-QPLSSTLSPIASLDKHNRTHTGERPFSCEF 604

  Fly   435 CNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLVHTVQCEVCDLTIKS 499
            |.::||.|..|..|:...|...|...|:|||..|.:...::.|.:. |..|...:|..|......
Mouse   605 CEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRR-HKGVRKFECTECGYKFTR 668

  Fly   500 KGNYRRHCKSQSHKDNLVKFGKNNDKTKDSN-RRKGART---TDEKL---------DIEASSS 549
            :.:.|||.:.             :|:.::.| |::..|.   .|||:         |:|..|:
Mouse   669 QAHLRRHMEI-------------HDRVENYNPRQRKLRNLIIEDEKMVVVALQPPADLEVGSA 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 322..343 CDD:275368 5/28 (18%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 7/24 (29%)
C2H2 Zn finger 490..506 CDD:275368 3/15 (20%)
Zbtb48XP_017175372.1 BTB_POZ_ZBTB48_TZAP_KR3 38..145 CDD:349541
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..351 CDD:372612 8/27 (30%)
C2H2 Zn finger 344..395 CDD:275368 10/50 (20%)
zf-H2C2_2 387..410 CDD:372612 4/22 (18%)
C2H2 Zn finger 403..424 CDD:275368 7/20 (35%)
PHA03247 <426..583 CDD:223021 23/161 (14%)
zf-H2C2_2 586..610 CDD:372612 2/23 (9%)
C2H2 Zn finger 602..623 CDD:275368 7/20 (35%)
C2H2 Zn finger 631..651 CDD:275368 6/20 (30%)
zf-H2C2_2 644..668 CDD:372612 5/24 (21%)
zf-C2H2 657..679 CDD:333835 5/34 (15%)
C2H2 Zn finger 659..679 CDD:275368 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.