DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chn and ZNF510

DIOPT Version :9

Sequence 1:NP_001246331.1 Gene:chn / 36678 FlyBaseID:FBgn0015371 Length:1286 Species:Drosophila melanogaster
Sequence 2:NP_001300988.1 Gene:ZNF510 / 22869 HGNCID:29161 Length:683 Species:Homo sapiens


Alignment Length:434 Identity:85/434 - (19%)
Similarity:131/434 - (30%) Gaps:130/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TSGGKLQSYAHVNQ-------------------QQQQQQQPHQSTPKSKKHRQEHAAELIYASPS 248
            |..||  .:.|:||                   .:..:..|..:....|.|..:....:|..:|.
Human   302 TGTGK--KHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPL 364

  Fly   249 TSANAAQNLAQSTPTSAPSNSSGGSTSSSGGGGGRKKAAQAAAAAAAANGVHIQKRYACTHCPYS 313
            .|.:..|...:|:....                 .||:.|.:..........:.|.|.|..|..|
Human   365 VSNDRTQTWVKSSEYHE-----------------NKKSYQTSVHRVRRRSHSMMKPYKCNECGKS 412

  Fly   314 TDRRDLYTRHENIHKDEKPFQCYACLKQFNRADHVKKHFLRMH-RELQYDIN---KT-------R 367
            ..::....:|:..|..||||:|..|.|.|::..|:..| .|:| .|..|..|   ||       |
Human   413 FCQKGHLIQHQRTHTGEKPFECSECGKTFSQKSHLSTH-QRIHTAEKPYKCNECGKTFVQKSTLR 476

  Fly   368 RHVSAGSGSSGSGSSGSG----------SHH--SGGRGNVTINSAGVNI---DNAFLEAQRHPTS 417
            .|....:|......|..|          .||  ..|..:...|..|...   .|..:..:.|   
Human   477 GHQRIHTGEKPYECSECGKTFVQKSTLRDHHRIHTGEKSFQCNQCGKTFGQKSNLRIHQRTH--- 538

  Fly   418 SSMSIVETIEAVASATDMPLAQLKQEKMDDGAGVVLPLHVGVMQQPVASSSSGSSGSHGGNGNGG 482
                   |.|......:...:..:::.:             :..|.          :|.|     
Human   539 -------TGEKTYQCNECEKSFWRKDHL-------------IQHQK----------THTG----- 568

  Fly   483 SGSGLLKPKREKRFTCCYCPWSGADKWGLKRHLNTHT--KPFVCLLCDYKAARSERLATHVLKVH 545
                      ||.|.|..|..:.|....|:.|...||  |||.|..|..|..|...|:.| .::|
Human   569 ----------EKPFKCNECGKTFARTSTLRVHQRIHTGEKPFKCNECGKKFVRKAILSDH-QRIH 622

  Fly   546 NKR---ACSKCSYLADTQEEYQAHMSDVHPHDNRPARSGNGNQS 586
            ...   .|:||......:...:.|.           |:.:|.:|
Human   623 TGEKPFQCNKCGKTFGQKSNLRIHQ-----------RTHSGEKS 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chnNP_001246331.1 C2H2 Zn finger 307..327 CDD:275368 4/19 (21%)
C2H2 Zn finger 335..356 CDD:275368 7/20 (35%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..545 CDD:275368 6/20 (30%)
ZNF510NP_001300988.1 KRAB 46..105 CDD:214630
KRAB 46..85 CDD:279668
COG5048 240..663 CDD:227381 85/434 (20%)
C2H2 Zn finger 256..276 CDD:275368
zf-C2H2 404..426 CDD:278523 5/21 (24%)
C2H2 Zn finger 406..426 CDD:275368 4/19 (21%)
zf-H2C2_2 418..443 CDD:290200 10/24 (42%)
C2H2 Zn finger 434..454 CDD:275368 7/20 (35%)
zf-H2C2_2 446..471 CDD:290200 9/25 (36%)
C2H2 Zn finger 462..482 CDD:275368 5/19 (26%)
zf-H2C2_2 475..499 CDD:290200 5/23 (22%)
C2H2 Zn finger 490..510 CDD:275368 4/19 (21%)
zf-H2C2_2 503..525 CDD:290200 5/21 (24%)
zf-C2H2 516..538 CDD:278523 3/21 (14%)
C2H2 Zn finger 518..538 CDD:275368 3/19 (16%)
zf-H2C2_2 530..555 CDD:290200 4/34 (12%)
C2H2 Zn finger 546..566 CDD:275368 1/42 (2%)
zf-H2C2_2 558..583 CDD:290200 8/62 (13%)
C2H2 Zn finger 574..594 CDD:275368 5/19 (26%)
zf-H2C2_2 587..611 CDD:290200 10/23 (43%)
C2H2 Zn finger 602..622 CDD:275368 6/20 (30%)
zf-H2C2_2 615..637 CDD:290200 6/22 (27%)
zf-C2H2 628..650 CDD:278523 5/32 (16%)
C2H2 Zn finger 630..650 CDD:275368 5/30 (17%)
C2H2 Zn finger 658..676 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24392
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.