DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chn and Zfp119a

DIOPT Version :9

Sequence 1:NP_001246331.1 Gene:chn / 36678 FlyBaseID:FBgn0015371 Length:1286 Species:Drosophila melanogaster
Sequence 2:XP_011244531.1 Gene:Zfp119a / 104349 MGIID:1345189 Length:558 Species:Mus musculus


Alignment Length:410 Identity:73/410 - (17%)
Similarity:113/410 - (27%) Gaps:163/410 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 QWTSGGKLQSYAHVNQQQQQQQQPHQSTPKSK---------KHRQEHAAELIYASPSTSANAAQN 256
            ||.......||..|::.....:.|::.....|         ||.:.|..|..|            
Mouse   278 QWGKAFSYPSYLQVHETIHTGKSPYECNQCGKTFAYKSHFHKHERIHTGEKPY------------ 330

  Fly   257 LAQSTPTSAPSNSSGGSTSSSGG---------GGGRKKAAQAAAAAAAANGVHIQKR-------Y 305
                     ..|..|.:.||:..         |....:.:|...|.|..|.:||.:|       |
Mouse   331 ---------ECNRCGKAFSSNSNLQRHERIHTGEKPYECSQCGKAFAYRNSLHIHERNHTGEKPY 386

  Fly   306 ACTHCPYSTDRRDLYTRHENIHKDEKPFQCYACLKQFNRADHVKKHFLRMHR-ELQYDINKTRRH 369
            .|..|............|..:|..|||::|:.|.|.|:...|::.| .|:|. |..|..|:    
Mouse   387 KCYQCGKDFASNSNLQIHRRVHSGEKPYKCFECGKHFSCNSHLQMH-ERIHTGEKPYKCNQ---- 446

  Fly   370 VSAGSGSSGSGSSGSGSHHSGGRGNVTINSAGVNIDNAFLEAQRHPTSSSMSIVETIEAVASATD 434
                   .|...:.|.|.|...|                                          
Mouse   447 -------CGKTFAYSSSFHMHER------------------------------------------ 462

  Fly   435 MPLAQLKQEKMDDGAGVVLPLHVGVMQQPVASSSSGSSGSHGGNGNGGSGSGLLKPKREKRFTCC 499
                                .|.|  ::|...:..|.:.::                      ||
Mouse   463 --------------------THTG--EKPYECNQCGKAFAY----------------------CC 483

  Fly   500 YCPWSGADKWGLKRHLNTHT--KPFVCLLCDYKAARSERLATHVLKVHNKR--ACSKC----SYL 556
            :          |:||...||  ||:.|..|....|....|..|......::  .|::|    :.|
Mouse   484 H----------LQRHERCHTGEKPYECNQCGKAFAYLSSLHKHERNHTGEKLFECNQCGKVFACL 538

  Fly   557 ADTQEEYQAHMSDVHPHDNR 576
            :..||..:.|...:....|:
Mouse   539 STLQEHKRIHTDKIPKETNK 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chnNP_001246331.1 C2H2 Zn finger 307..327 CDD:275368 3/19 (16%)
C2H2 Zn finger 335..356 CDD:275368 7/20 (35%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..545 CDD:275368 5/20 (25%)
Zfp119aXP_011244531.1 KRAB 17..57 CDD:366587
C2H2 Zn finger 249..268 CDD:275368
COG5048 <267..461 CDD:227381 47/215 (22%)
C2H2 Zn finger 280..296 CDD:275368 3/15 (20%)
C2H2 Zn finger 304..324 CDD:275368 3/19 (16%)
C2H2 Zn finger 332..352 CDD:275368 4/19 (21%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 388..408 CDD:275368 3/19 (16%)
C2H2 Zn finger 416..436 CDD:275368 7/20 (35%)
C2H2 Zn finger 444..464 CDD:275368 6/92 (7%)
zf-H2C2_2 459..481 CDD:372612 5/85 (6%)
C2H2 Zn finger 472..492 CDD:275368 6/51 (12%)
zf-H2C2_2 484..509 CDD:372612 9/34 (26%)
C2H2 Zn finger 500..520 CDD:275368 5/19 (26%)
C2H2 Zn finger 528..548 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24392
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.