DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7639 and TOC75-I

DIOPT Version :9

Sequence 1:NP_995838.1 Gene:CG7639 / 36675 FlyBaseID:FBgn0033989 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_174821.1 Gene:TOC75-I / 840488 AraportID:AT1G35860 Length:399 Species:Arabidopsis thaliana


Alignment Length:371 Identity:73/371 - (19%)
Similarity:128/371 - (34%) Gaps:120/371 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LHELGIFKDVSVHIDVSRGADASPQG---YEVTFKGNEMSRMMGSAGTEI------------GQN 117
            :|.||:|.    :|::....:...:|   .||..:..:...:.|||...|            .|.
plant   112 IHSLGLFS----NIEIMPIPNEKREGGVIVEVKLQETDQKSVEGSADRSIVPDPGGYPSLASSQP 172

  Fly   118 EGSLRTELTIPNILGRGENISLQGSYSSTR----ANDL--QLKFWKPFFHTRFKENRPEMSFSIF 176
            .|::..|  .|||  :|.|.||.||.:::.    .:||  :|::..|:..............|||
plant   173 SGTISFE--HPNI--KGLNRSLIGSIATSNFLNPEDDLSFKLEYVHPYLDGVSNPRNRTFKTSIF 233

  Fly   177 RQTDRFDISSFQTTNIGYLVDFSAHTMVGVDLTHSLQYENAIRDVGLLNKSVPFAIRDHCGPKLA 241
            ..:   .:||..|...|                    :|.|:..: |::::   ||         
plant   234 NSS---KLSSVLTGGPG--------------------FEEAVAPI-LMDRA---AI--------- 262

  Fly   242 SLLRYSVVYDNRDGNVFPTRGIYLKSVNEYCGLGGNVAYTSSTAHGELNVPLFAGLVAQFCARVG 306
                      |.:|:.....|:   .::....|.||:.        :.|.....|.:      ||
plant   263 ----------NVNGSPTTLSGM---GIDRVAFLQGNIT--------QDNTKFVNGAI------VG 300

  Fly   307 ---VVKETKNTTQLPISSLFYCGGPLTLRGFK--FGGAGPVVESTPIGAQSFWCTGAHLWAPLPF 366
               :::..:....||....|..|||..:|..|  .|.|..:||..         .||.|...:  
plant   301 ERKIIQVDQCLGDLPGYDAFSLGGPNYVRYTKGELGAARNIVELK---------VGAELRVNV-- 354

  Fly   367 AGVFKNLASHFRMHFFYNIGNNN--------SFSTENMRSAFGMGL 404
                ||...:.......::|::.        :|..|...|::|:|:
plant   355 ----KNTQGYAFAEHGNDLGSSKDMKGNPTAAFRREGHGSSYGVGM 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7639NP_995838.1 Bac_surface_Ag 129..442 CDD:279448 57/295 (19%)
TOC75-INP_174821.1 PLN03138 <3..399 CDD:215598 73/371 (20%)
Bac_surface_Ag <311..395 CDD:279448 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.