DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7639 and TOC75-IV

DIOPT Version :9

Sequence 1:NP_995838.1 Gene:CG7639 / 36675 FlyBaseID:FBgn0033989 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001329162.1 Gene:TOC75-IV / 826486 AraportID:AT4G09080 Length:407 Species:Arabidopsis thaliana


Alignment Length:406 Identity:92/406 - (22%)
Similarity:139/406 - (34%) Gaps:134/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GADASPQGYEVTFKGNEMSRMMGSAGTEIGQNEGSLRTELTIPNILGRGENISLQGSYSSTRAND 150
            |.|.|...:|||...|     :|...:| |.|: ||...:||.||.             :.:.:|
plant    54 GLDPSLDFFEVTGNCN-----LGRPNSE-GSNQ-SLMGSVTIRNIF-------------NPKLDD 98

  Fly   151 LQLKFWKPFFHTRFKE------NRP-EMSFSIFRQTDRFDISSFQTTNIGYLVDFSAHTMVGVD- 207
            |..|    ..:.||.|      ||. :.||...|:     :|...|...|| .|......||.| 
plant    99 LLSK----IEYVRFLEAVKKPRNRTFKTSFFNSRK-----LSPVFTGGPGY-EDLVPPMFVGRDC 153

  Fly   208 --------------LTHSLQYENAIR----------------DVGLLNKSVPFAIR----DHCGP 238
                          ||:.:.:|..|.                |.|:.....|..:.    ||...
plant   154 LKATITENLTRQRELTYGVMFEEIITRDENRRISENGLLLSPDGGISINGPPTTLSGTGIDHIAT 218

  Fly   239 KLASLLRYSVVYDNR---DGNVFPTRGIYLKSVNEYCGLGGNVAYTSSTAHGELNVPLFAGLVAQ 300
            ..|::.|     ||.   :|.|...:.|:  .|::..|:|.|  :.....| :|::..|..|.. 
plant   219 LQANITR-----DNTKLVNGAVVGEKNIF--QVDQGLGIGNN--FPLFNRH-QLSLTSFIQLKQ- 272

  Fly   301 FCARVGVVKETKNTTQ----------------LPISSLFYCGGPLTLRGFKFGGAGPVVESTPIG 349
                   |:|..:..|                ||...:|..|||.::||:..|..|.......:|
plant   273 -------VEEGSDKPQPPVLVLHGRYGGCIGDLPSYDVFALGGPNSVRGYSMGELGAAKNILELG 330

  Fly   350 AQ-SFWCTGAHLWAPLPFAGVFKNLASHFRMH-----FFYNIGNNNSFSTENMRSAFGMGLAVKL 408
            |: .......|::|   ||....:|.|...:.     .:..:|:.:|:           ||.|||
plant   331 AEIRIPVKNTHVYA---FAEHGNDLGSSKDVKGNPTGLYRKMGHGSSY-----------GLGVKL 381

  Fly   409 AERARIELNYCVPVRH 424
               ..:...|  .|||
plant   382 ---GMVRAEY--TVRH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7639NP_995838.1 Bac_surface_Ag 129..442 CDD:279448 77/363 (21%)
TOC75-IVNP_001329162.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.