DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7639 and TOC75-III

DIOPT Version :9

Sequence 1:NP_995838.1 Gene:CG7639 / 36675 FlyBaseID:FBgn0033989 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_190258.1 Gene:TOC75-III / 823827 AraportID:AT3G46740 Length:818 Species:Arabidopsis thaliana


Alignment Length:454 Identity:89/454 - (19%)
Similarity:154/454 - (33%) Gaps:128/454 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SYLHELGIFKDVSVHIDVSRGADASPQGYEVTFKGNEMSRMMGSAGTE--IGQNEGSLRT----- 123
            |.::.||:|.::.|:   .|..:.:..|..|..|..|:.:......||  |....|...|     
plant   414 SNINSLGLFSNIEVN---PRPDEKNEGGIIVEIKLKELEQKSAEVSTEWSIVPGRGGAPTLASFQ 475

  Fly   124 ---ELTIPNILGRGENISLQGSYSSTR----ANDL--QLKFWKPFFHTRFKENRPEMSFSIFRQ- 178
               .:|..:...:|.|.||.||.:::.    .:||  :|::..|:....:.........|.|.. 
plant   476 PGGSVTFEHRNLQGLNRSLMGSVTTSNFLNPQDDLSFKLEYVHPYLDGVYNPRNRTFKTSCFNSR 540

  Fly   179 -------------------TDRFDISSFQTTNIGYLVDFSAHTMVGVDLT------HSLQYENAI 218
                               .||..:.:..|.|......|: :.:|..::|      |.......:
plant   541 KLSPVFTGGPGVEEVPPIWVDRAGVKANITENFTRQSKFT-YGLVMEEITTRDESSHIAANGQRL 604

  Fly   219 RDVGLLNKSVPFAIRDHCGPKLASLLRYSVVYDNR---DGNVFPTRGIYLKSVNEYCGLGGNVAY 280
            ...|.::...|.......|....:.|:.::..||.   :|.|...|.::  .|::..|:|....:
plant   605 LPSGGISADGPPTTLSGTGVDRMAFLQANITRDNTKFVNGAVVGQRTVF--QVDQGLGIGSKFPF 667

  Fly   281 TSSTAHGELNVPLF---------AG--------LVAQFCARVGVVKETKNTTQLPISSLFYCGGP 328
            .:   ..:|.:..|         ||        |...:...||         .||....|..|||
plant   668 FN---RHQLTMTKFIQLREVEQGAGKSPPPVLVLHGHYGGCVG---------DLPSYDAFVLGGP 720

  Fly   329 LTLRGFKFGGAGPVVESTPIGAQSFWCTGAHLWAPLPFAGVFKNLASHFRMHFFYNIGNNNSFST 393
            .::||:..|..|        .|::....||.:..|:      ||  :|  ::.|...||:...|.
plant   721 YSVRGYNMGELG--------AARNIAEVGAEIRIPV------KN--TH--VYAFVEHGNDLGSSK 767

  Fly   394 E------------NMRSAFGMGLAVKLAERARIELNYCVPVRHQDTDRILNG-----FQFGIGY 440
            :            ...|::|.|:.:.|     :...|.|.  |.      ||     |:||..|
plant   768 DVKGNPTAVYRRTGQGSSYGAGVKLGL-----VRAEYAVD--HN------NGTGALFFRFGERY 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7639NP_995838.1 Bac_surface_Ag 129..442 CDD:279448 73/381 (19%)
TOC75-IIINP_190258.1 PLN03138 8..818 CDD:215598 88/452 (19%)
Bac_surface_Ag 486..815 CDD:279448 70/374 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.