DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pcs and sh3bp5a

DIOPT Version :9

Sequence 1:NP_611010.4 Gene:pcs / 36674 FlyBaseID:FBgn0033988 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_682769.5 Gene:sh3bp5a / 555222 ZFINID:ZDB-GENE-111111-2 Length:444 Species:Danio rerio


Alignment Length:302 Identity:132/302 - (43%)
Similarity:187/302 - (61%) Gaps:9/302 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SAEDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGNCIEKAR 67
            |.|:.|:||:||.|||.||.:||.||:.|.|||::...||.:|.|:|.:|....||:|..:|:::
Zfish    16 SLEEEEVDPRIQGELEKLNQSTDNINQWETELEDSRQKFRAVLVEATVKLDEQVKKIGKAVEESK 80

  Fly    68 PYYEALDKAREAQIECQKAAVKFQRANEIHAAAKETVALAEQRFMSNSHEWQFDNAWQEMLNHAT 132
            ||:||...||:||:|.|||..::|||.||..|||||:||||:|.:..... |||:||||||||||
Zfish    81 PYWEARRAARQAQVEAQKATQEYQRAIEILRAAKETIALAEERLLEEDSR-QFDSAWQEMLNHAT 144

  Fly   133 QKVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPYFEEKQVCQDQLQTQKNR 197
            |:||:||..:.....||:.....:|||...::|||.:.:|:|||||||||.|.....||:..|.|
Zfish   145 QRVMEAEQSRTRSEMEHRETAAKYNAAISHMRQLEKKLKRTINKSRPYFELKAKYYLQLEQLKRR 209

  Fly   198 IQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGPREPGVGAELNSPTSSALPSLPDF 262
            :.|.|.::..||:.|.:||||||.||::||.:|.  .:..|||..|||||.:..|   :..:.:|
Zfish   210 VDERQAKLTQAKAEYRSALRNLETISDEIHERRR--LSAIGPRGRGVGAEDDGAT---IDDITNF 269

  Fly   263 QLELEKCDYPSIAGSQMSLGAKTPQAAAETEDEEDACDYDET 304
            ::|   .|..|:....:..|.....:..:.|..|.:|....|
Zfish   270 KME---SDGISMMSVNLEDGCNGTTSEEDPETSESSCSVSST 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pcsNP_611010.4 SH3BP5 8..235 CDD:283045 112/226 (50%)
sh3bp5aXP_682769.5 SH3BP5 24..246 CDD:283045 110/224 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586541
Domainoid 1 1.000 217 1.000 Domainoid score I2618
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3408
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D258813at33208
OrthoFinder 1 1.000 - - FOG0003963
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.