DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pcs and sh3bp5

DIOPT Version :9

Sequence 1:NP_611010.4 Gene:pcs / 36674 FlyBaseID:FBgn0033988 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_989213.2 Gene:sh3bp5 / 394821 XenbaseID:XB-GENE-959548 Length:437 Species:Xenopus tropicalis


Alignment Length:315 Identity:138/315 - (43%)
Similarity:188/315 - (59%) Gaps:35/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGNCIEKARPY 69
            |:.|:||:||.|||.||.:||:||:.|||||:|...||.:|.|:|.:|....||:|..:|.::||
 Frog    19 EEEEVDPRIQGELEKLNQSTDDINRREIELEDARQKFRSVLTEATLKLDEMVKKIGKAVEDSKPY 83

  Fly    70 YEALDKAREAQIECQKAAVKFQRANEIHAAAKETVALAEQRFMSNSHEWQFDNAWQEMLNHATQK 134
            :||...||:||:|.|||...||||.|:..|||||::|||||.:.:... |||:|||||||||||:
 Frog    84 WEARKVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKR-QFDSAWQEMLNHATQR 147

  Fly   135 VMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPYFEEKQVCQDQLQTQKNRIQ 199
            ||:.|.:|......|:.....:|||..:::|||.:.:|:||||:||||.|.....||:..|..:.
 Frog   148 VMEEEQKKTRSELVHKETAAKYNAAMGRMKQLEKKLKRTINKSKPYFELKAKYYLQLEQLKKTVD 212

  Fly   200 ELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGPREPGVGAELNSPTSSALPSLPDFQL 264
            |||.:::.||..|.|||:|||.||::||.:|.  .:..|||..|||:|.|:       ||.|   
 Frog   213 ELQAKLSLAKGEYKTALKNLEMISDEIHERRR--TSAMGPRGRGVGSEGNN-------SLED--- 265

  Fly   265 ELEKCDYPSIAGSQMSLGAKTPQAAAETEDEEDACDYDETGAGELRGVVDERDLE 319
             |..|...|.|.|..|          |..||::           |..:|.|.|.|
 Frog   266 -LSACKLDSDAISMTS----------EVFDEDN-----------LSSLVSEEDSE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pcsNP_611010.4 SH3BP5 8..235 CDD:283045 112/226 (50%)
sh3bp5NP_989213.2 SH3BP5 21..249 CDD:283045 112/230 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2618
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3368
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D258813at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103613
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.