DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pcs and Sh3bp5

DIOPT Version :9

Sequence 1:NP_611010.4 Gene:pcs / 36674 FlyBaseID:FBgn0033988 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_038950099.1 Gene:Sh3bp5 / 117186 RGDID:620220 Length:488 Species:Rattus norvegicus


Alignment Length:449 Identity:149/449 - (33%)
Similarity:211/449 - (46%) Gaps:125/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGNCIEKARPY 69
            |:.|:||:||.|||.||.:||:||:.|.|||:|...||.:|.|:|.:|...:||:|..:|.::||
  Rat    39 EEEEVDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELAKKIGKAVEDSKPY 103

  Fly    70 YEALDKAREAQIECQKAAVKFQRANEIHAAAKETVALAEQRFMSNSHEWQFDNAWQEMLNHATQ- 133
            :||...||:||:|.|||...||||.|:..|||||::|||||.:.:... |||:||||||||||| 
  Rat   104 WEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKR-QFDSAWQEMLNHATQR 167

  Fly   134 ------------------------------KVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLED 168
                                          |||:||..|......|:.....:|||..:::|||.
  Rat   168 FWKPGSPKPRLMCMLSDEDPFLVLKGLSPLKVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEK 232

  Fly   169 RFRRSINKSRPYFEEKQVCQDQLQTQKNRIQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDF 233
            :.:|:||||:||||.|.....||:..|..:.:||.::|.||..|..||::|||||::||.:|.. 
  Rat   233 KLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIHERRRS- 296

  Fly   234 PTPPGPREPGVGAE------LNSPTSSALP---SLPDFQLELEKC-------------------- 269
             ...|||..|||||      .|.|.|...|   |:.....|.:.|                    
  Rat   297 -NAMGPRGCGVGAEGSITSVENLPASKPEPDAISVASEAFEDDNCGNLVSEDDSETQSVSSFSSG 360

  Fly   270 ---------DYPSIA-------GSQMSL-----------------GAKTPQAAAETEDEEDACD- 300
                     .:|::|       .|.:||                 ||.:|:...|..|..:..: 
  Rat   361 PTSPSEMPDQFPAVARPGSLDLPSPVSLSEFGMMFPILGPRSECSGASSPECEVERGDRAEGAEN 425

  Fly   301 -----------YDETGAG----------ELRGVVDERDLEALRQKVKILAVRPIEGGDG 338
                       ...|.||          .|.|       :||..::|.|:::..:|.:|
  Rat   426 KMSDKANNNRVLSSTSAGGGRSRSQSSTSLEG-------QALETRMKQLSLQCSKGREG 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pcsNP_611010.4 SH3BP5 8..235 CDD:283045 112/257 (44%)
Sh3bp5XP_038950099.1 SH3BP5 43..302 CDD:398785 112/261 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D258813at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104684
Panther 1 1.100 - - LDO PTHR19423
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.