DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and Inppl1

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_075233.1 Gene:Inppl1 / 65038 RGDID:68396 Length:1257 Species:Rattus norvegicus


Alignment Length:293 Identity:63/293 - (21%)
Similarity:96/293 - (32%) Gaps:119/293 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VSSPSLEEGGFNLPRETSVALRLKDEVGGTSTAAPTTGGPGGGGATVVGAPPPGAGKP------- 144
            ::.|:.:.|....||           ||..|::...:||.         .|||....|       
  Rat  1020 ITVPAPQLGRHRTPR-----------VGEGSSSDEDSGGT---------LPPPDFPPPPLPDSAI 1064

  Fly   145 -------------------GVAMVPPPPVFCATLREPL---THKAAVYYHQQLALQEDQGIDLTQ 187
                               |.|..||||.  |..|.||   |..|:.:. :::|..:|:...:.|
  Rat  1065 FLPPNLDPLSMPVVRGRSVGEARGPPPPK--AHPRPPLPPGTSPASTFL-EEVASADDRSCSVLQ 1126

  Fly   188 ----------SPGRDSPGSSSGSAGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSP---- 238
                      |||   ||.|            |.|.:........|.|..|    .|||.|    
  Rat  1127 MAKTLSEVDYSPG---PGRS------------ALLPNPLELQLPRGPSDYG----RPLSFPPPRI 1172

  Fly   239 ------------------RCSSVSSCSIGSVDRQRNDELIIDWLLEMKHEEYAQLFIAAGY-DLP 284
                              |.|.:....:|:            ||..:..|.|.:..:..|: ||.
  Rat  1173 RESIQEDLAEEAPCPQGGRASGLGEAGMGA------------WLRAIGLERYEEGLVHNGWDDLE 1225

  Fly   285 TIARMTPEDLTAIGIKNPHHRERIKQRIDKLQV 317
            .::.:|.|||...|:::|.|:..:   :|.||:
  Rat  1226 FLSDITEEDLEEAGVQDPAHKRLL---LDTLQL 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 17/65 (26%)
SAM 260..316 CDD:197735 15/56 (27%)
SAM_caskin1,2_repeat2 320..390 CDD:188897
SAM 326..387 CDD:197735
Caskin-tail <887..912 CDD:293238
Inppl1NP_075233.1 SH2_SHIP 17..119 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..181
INPP5c_SHIP2-INPPL1 425..728 CDD:197335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..986
SH3-binding 945..950
NPXY motif 984..987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1004..1115 25/117 (21%)
SAM_Ship2 1193..1255 CDD:188890 18/76 (24%)
SAM 1201..1257 CDD:197735 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.