DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and SAMSN1

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001382787.1 Gene:SAMSN1 / 64092 HGNCID:10528 Length:701 Species:Homo sapiens


Alignment Length:462 Identity:97/462 - (20%)
Similarity:161/462 - (34%) Gaps:132/462 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HHPHHQPSIPLYRL-------SGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGF-NLPRETSVA 106
            ||....|..||:..       .||..|..:......:..|.|.:....|.....| |..|..:.:
Human   298 HHWKPFPENPLWTCLDFQIAQVGPWDHCSSCIRHTRLKSSCSDMDLLHSWRSSSFGNFDRFRNNS 362

  Fly   107 LRLKDEVGGTSTAAPTTGG------PGGGGATVVGAPPPGAGKPGVAMVPPPPVFCATLREPLTH 165
            |...|:........||.|.      ...||         |.||...|:       ..|:::.:..
Human   363 LSKPDDSTEAHEGDPTNGSGEQSKTSNNGG---------GLGKKMRAI-------SWTMKKKVGK 411

  Fly   166 KAAVYYHQQLALQEDQGIDLTQSPGRDSP---GSSSGSAGSGSRHSTASLDSGRASSYLTGVS-- 225
            |    |.:.|:.::|:.......|.|:|.   |:.:......:..|..||.||::||  :|::  
Human   412 K----YIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSS--SGITSC 470

  Fly   226 SSGASIR--------APLSSPRCS--------SVSSCSIGSVDRQRNDELIID---------W-- 263
            |.|.|.|        .|.|.|.|.        :.|.....|:..::.|  |||         |  
Human   471 SDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGD--IIDIICKTPMGMWTG 533

  Fly   264 LLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIKNPHHRERIKQRIDKLQVLDNLPHFVPGS 328
            :|..|...:..:::    |:.:.....|:.:.|      :.|...|:               ..:
Human   534 MLNNKVGNFKFIYV----DVISEEEAAPKKIKA------NRRSNSKK---------------SKT 573

  Fly   329 IEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRV--KDIISG 391
            ::|:|:.:.|:||...||...|:|:.|:..:....|.::.|.....::::|.|.:..  ::||  
Human   574 LQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEII-- 636

  Fly   392 KWNPGGANAYQQQEYQRKPWQFNVPIP-STPSYVPTTRVSWDDTKIYATSSVLNSTAPSGSSCLN 455
                      |:||        |.|.| |..|.:...:...||             .|..|.|..
Human   637 ----------QEQE--------NEPEPLSLSSDISLNKSQLDD-------------CPRDSGCYI 670

  Fly   456 SSLANGD 462
            || .|.|
Human   671 SS-GNSD 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 12/75 (16%)
SAM 260..316 CDD:197735 11/66 (17%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 15/71 (21%)
SAM 326..387 CDD:197735 14/62 (23%)
Caskin-tail <887..912 CDD:293238
SAMSN1NP_001382787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.