DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and SASH3

DIOPT Version :9

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_006724826.1 Gene:SASH3 / 54440 HGNCID:15975 Length:430 Species:Homo sapiens


Alignment Length:458 Identity:95/458 - (20%)
Similarity:159/458 - (34%) Gaps:135/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SGPLRHHQNHQADDGISMSGSSIVSSPSLEEGG-----------------FNLPRETSVALRLKD 111
            |.|:...:....||.|....|.:   |:.|:.|                 .|......:...|.:
Human    37 SSPVVSEKEFNLDDNIPEDDSGV---PTPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSE 98

  Fly   112 EVGGT---STAAPTT-----GGPG----------------------GGGATVVGAPPPGAGKPGV 146
            |:..|   .:|:||:     ..||                      ....:.:.:|.||:|..|.
Human    99 EMADTLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGSFGE 163

  Fly   147 AMVPPPP----VFCATLREPLTHKAAVYYHQQLALQEDQGIDLTQSPGRDSPG---SSSGSA--G 202
            .  ||.|    .||...|.......:.|.|..|.||.           |.:.|   |.:|.|  |
Human   164 E--PPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQV-----------RSASGLLWSLAGCAQKG 215

  Fly   203 SGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRCSSVSSCSIGSVDRQRNDEL-IID---- 262
            |.:.....|:..|:...|...:        ||.|||            :.:|:.|.: ||:    
Human   216 SWTEPGYDSVSGGQGPPYPLSL--------APFSSP------------LPQQKGDVIQIIEKPPV 260

  Fly   263 --W--LLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIKNPHHRERIKQRIDKLQVLDNLPH 323
              |  ||..|...:..:::          .:.||:  |:|...|..|:...:|          |.
Human   261 GTWLGLLNGKVGSFKFIYV----------DVLPEE--AVGHARPSRRQSKGKR----------PK 303

  Fly   324 FVPGSIEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDI 388
              |.::.|.|:.:.|||:...||...|:|:.|..::....|.::.|:...|:.|:|.|.:.:.| 
Human   304 --PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLD- 365

  Fly   389 ISGKWNPGGANAYQQQEYQRKP-----WQFNVPIPSTPSYVPTTRVSWDDTKIYATSSVLNSTAP 448
                ::.|...|.:..|..::|     .:..|.||........:....||.::..|...|...:.
Human   366 ----YDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL 426

  Fly   449 SGS 451
            :|:
Human   427 AGA 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 15/73 (21%)
SAM 260..316 CDD:197735 13/63 (21%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 19/69 (28%)
SAM 326..387 CDD:197735 17/60 (28%)
Caskin-tail <887..912 CDD:293238
SASH3XP_006724826.1 SLY 21..174 CDD:289268 26/141 (18%)
SH3 176..281 CDD:302595 29/145 (20%)
SAM_SASH3 300..367 CDD:188959 20/83 (24%)
SAM 302..366 CDD:197735 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.