DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and CG17625

DIOPT Version :10

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_651078.1 Gene:CG17625 / 42678 FlyBaseID:FBgn0039002 Length:142 Species:Drosophila melanogaster


Alignment Length:145 Identity:41/145 - (28%)
Similarity:68/145 - (46%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 DWLLEMKHEEYAQLFIAAGYDLPTIAR---MTPEDLTAIGIKNPHHRERIKQRIDKLQVLDNLP- 322
            |||:.:..|:|...|:..|||  :|.|   :...||..:|:.||.||   |..::.::.|.|.| 
  Fly     8 DWLVLLTMEKYIGKFLERGYD--SIERCKLIIVSDLIMLGVDNPAHR---KLLLEGVRFLVNAPE 67

  Fly   323 HFV---PGSIEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKR 384
            .|:   |..:.|.:: |:|:..::  |..:.|.:.:|     :.||......|...:|.|    .
  Fly    68 QFICKEPCELHEEIE-LKLDPDVE--LFASLKCLENV-----DFLETPVPYSLTSPQKTL----T 120

  Fly   385 VKDIISGKWNPGGAN 399
            .:|  |.|||..|.:
  Fly   121 TRD--SCKWNVKGVD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896 19/59 (32%)
SAM_caskin1,2_repeat2 320..390 CDD:188897 16/73 (22%)
Caskin-tail <887..912 CDD:465209
CG17625NP_651078.1 SAM_Samd5 2..64 CDD:188926 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.