DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckn and SAMD5

DIOPT Version :10

Sequence 1:NP_611009.1 Gene:ckn / 36673 FlyBaseID:FBgn0033987 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_016866339.1 Gene:SAMD5 / 389432 HGNCID:21180 Length:189 Species:Homo sapiens


Alignment Length:101 Identity:28/101 - (27%)
Similarity:50/101 - (49%) Gaps:13/101 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 IEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDIISGKW 393
            :.|||:.|:|.:|.:..::..|..:....|:...||:.||::...|:::||.|::|:::     .
Human     6 VYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLRE-----Q 65

  Fly   394 NPGGANAYQQQEYQRKPWQFNVPIPSTPS-YVPTTR 428
            :...|..|...|.|..|       |..|: .|||.|
Human    66 DANAAGLYFTLEPQPAP-------PGPPADAVPTGR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cknNP_611009.1 SAM_caskin1,2_repeat1 254..319 CDD:188896
SAM_caskin1,2_repeat2 320..390 CDD:188897 17/60 (28%)
Caskin-tail <887..912 CDD:465209
SAMD5XP_016866339.1 SAM_Samd5 2..64 CDD:188926 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.